SecReT4
Effector Protein ID: 340791240
T4SS name [ID]VirB [366]
Gene symbol-
Locus tagBPI_I1691
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015857] [Browse all T4SS(s) in this replicon]
Location [Strand]1612544..1612861 [+]
Producthypothetical protein
Effector typeProtein
DescriptonVceA
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to VceA. Function unknown
UniProt IDC9TY84
KEGG IDbpp:BPI_I1691
PDB IDNA
Domain hit(s) vs Pfam PepSY_2 [PF13670], Evalue: 1.7e-21, Aligned region: 5..85
Protein Sequence: 105 a.a.     [Download]
>gi|340791240|ref|YP_004756705.1| hypothetical protein BPI_I1691 [Brucella pinnipedialis B2/94]
MKIIITAAALVALSATGAMAQKTQCDAKPLDEKSIDALVQLSNEFTWKISEMEIDDGCYELHVTDENGNV
LKVKVDPETMKVVAGKVKRYGDGTPAKDKGHAPKN
-
Nucleotide Sequence: 318 bp     [Download]
>gi|340789630|ref|NC_015857.1|:1612544-1612861 Brucella pinnipedialis B2/94 chromosome 1, complete sequence
ATGAAAATCATCATCACGGCAGCAGCCCTGGTTGCACTGTCCGCCACGGGCGCAATGGCCCAAAAAACCC
AATGCGATGCAAAGCCGCTGGATGAGAAGTCCATCGATGCCTTGGTACAGTTGTCGAACGAATTTACGTG
GAAAATTTCCGAAATGGAGATTGACGACGGCTGTTATGAGCTGCACGTTACCGATGAAAACGGCAATGTC
CTCAAGGTCAAGGTGGACCCTGAAACGATGAAGGTGGTTGCTGGCAAAGTAAAGCGGTACGGCGATGGCA
CTCCGGCCAAGGACAAGGGCCACGCGCCCAAGAACTAG
 Primer design