SecReT4
Effector Protein ID: 340791592
T4SS name [ID]VirB [366]
Gene symbol-
Locus tagBPI_I2064
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015857] [Browse all T4SS(s) in this replicon]
Location [Strand]1958568..1959029 [-]
Productcyclic nucleotide-binding protein
Effector typeProtein
DescriptonBPE005
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to BPE005. Function unknown
UniProt IDC9TW68
KEGG IDbpp:BPI_I2064
PDB IDNA
Domain hit(s) vs Pfam cNMP_binding [PF00027], Evalue: 9.8e-21, Aligned region: 35..122
Protein Sequence: 153 a.a.     [Download]
>gi|340791592|ref|YP_004757057.1| cyclic nucleotide-binding protein [Brucella pinnipedialis B2/94]
MALDDDIRILGTVGLFESFTPEQLRLLAFGAERLVLRAGRELFREGQSADCAYIIVTGTITLFHEGDEGR
VTIRPVGPGAILGEMALIAQTTRLTGAVADVETEVIRISRSIFRRILEEYPEVAAALHAHISRNLVELIG
QIEQVAPRLANRD
-
Nucleotide Sequence: 462 bp     [Download]
>gi|340789630|ref|NC_015857.1|:c1959029-1958568 Brucella pinnipedialis B2/94 chromosome 1, complete sequence
ATGGCGCTAGACGACGATATTCGCATTCTCGGCACGGTGGGCCTGTTCGAGTCTTTCACGCCCGAACAGT
TGCGCCTGCTTGCCTTCGGTGCGGAGCGGCTTGTCCTGCGTGCGGGACGCGAGCTTTTCCGCGAGGGCCA
GAGTGCCGATTGCGCCTATATCATCGTTACCGGCACGATTACCCTGTTTCATGAAGGTGATGAAGGGCGG
GTCACGATCCGCCCTGTCGGCCCCGGCGCGATATTGGGGGAAATGGCGCTCATCGCCCAGACCACTCGTC
TCACCGGCGCGGTGGCGGATGTGGAAACCGAAGTCATCCGCATCAGCCGCTCCATCTTCCGGCGCATTCT
GGAAGAATACCCGGAAGTGGCCGCCGCGCTTCATGCGCATATCAGCCGCAATCTTGTCGAGCTTATCGGC
CAGATCGAGCAGGTCGCGCCGCGGCTTGCAAACCGCGACTGA
 Primer design