SecReT4
Effector Protein ID: 340791886
T4SS name [ID]VirB [366]
Gene symbol-
Locus tagBPI_II124
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]122274..122735 [-]
Producthypothetical protein
Effector typeProtein
DescriptonBPE123
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to BPE123. Function unknown
UniProt IDC9U0E5
KEGG IDbpp:BPI_II124
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 153 a.a.     [Download]
>gi|340791886|ref|YP_004757350.1| hypothetical protein BPI_II124 [Brucella pinnipedialis B2/94]
MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAAASNGLERAVKAIRNERTDLTDASAKL
DARLAETQRVRREMDEAIEELNRLRKALSRDMRQARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRR
AVKKATVELAGQA
-
Nucleotide Sequence: 462 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c122735-122274 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGAGCTTGTTGCTGGCTAACGTGCTTTCCACATTGATGGCTCTTGCCTCGCTTGCGGCTTTGATCGTGG
TGGGCCGCAAGGCCAATGAAACCATCAGGCTCGGCAAGGTGCTGGCGCTGCGCGTCGCCGCCGCGTCAAA
CGGTCTGGAGCGCGCCGTAAAGGCGATCCGCAACGAACGTACCGACCTTACCGACGCCAGCGCCAAGCTT
GACGCCCGCCTTGCCGAAACGCAGCGCGTGCGCCGTGAAATGGACGAGGCGATCGAGGAATTGAACCGGC
TGCGCAAGGCGCTCTCGCGCGATATGCGCCAGGCGCGCATCTTGGCCGAAACGCCGCCACCCCGGCAGGA
GAAAACCCCGTCCGCCGCAGAACAACCGCTCCCCGCAGACAAGAACGCGCTGCCCGTTTTCGTGCGCCGC
GCGGTCAAGAAGGCAACCGTTGAACTGGCGGGACAGGCATGA
 Primer design