SecReT4
Effector Protein ID: 56416496
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM185
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]157060..159456 [+]
Producthypothetical protein
Effector typeProtein
DescriptonAM185
T4CP requirementT4CP Depedent
Target/EffectionUnknown
UniProt IDQ5PBL4
KEGG IDama:AM185
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 798 a.a.     [Download]
>gi|56416496|ref|YP_153570.1| hypothetical protein AM185 [Anaplasma marginale str. St. Maries]
MSSGGVVPPSPSVKDKGALSADLIGQETPASPAQRSQRQQPDSSVIASDRANLSPDVAHGEVAAKSKKGV
DKAAPIGSGADYSEVEAELEKIGALSSRQPSVPAQEPVQEPRVGTEAALRKASKDKGTLSADLIGQKTPA
SPAQRSQRKQQDSSVIASDRANLSPGAGHGEVAAKSKKRVDKATLIRNLISSGADYSEVEAELEKIGALS
SRQPSVSVQEPVQEPRVGTEAALRKASEEEAKIFSDSVVRLAEGRIRNYLERYNAGEERLGLTSDAIMSY
KRELQQKARENGREFTETENTMLWACVNMAALNPDAAASREFARQVNLSHDKRVAKLQPRDQTRWDDPAT
RDPNRAEFFFPTPKSIRGLPGADKYPRTLARLFPNPEAETPWALESAGRKLVAHIKAGLDVDTFDPSAPI
VGKPDAPEQPPIPTGGWSKQEQRKMVDGFLKDMEKAMDATREAVLRSNKERAKQREQRDAQFRNKITQQS
IEASIRSLERHGVTVNDEARKAIVERETAIAERVQVRENVRRAKVREEVRRADAELRKLTGVGETESAFA
KMGEMGVASSLTPDFYERAKVSKGARAATGMAETKEVSPPAPGFFQRMQKLMQHVVTRVVSKFFNKHAEQ
PLADQVASAVDNVKAQLRTDDTSKTVEAGVKQEKADLLAKDPLAKAADPLTKTDRRAKTADPLAKTTDQL
VKTDNTFAERTAEVQAELEVAGVRFSGQQPGVAVDISDMSATANSRQQQSASERVGQRPTLESAVREFAN
AVDAASKLEQRTARQQPAIQQPQSARGR
-
Nucleotide Sequence: 2397 bp     [Download]
>gi|56416370|ref|NC_004842.2|:157060-159456 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTCGTCCGGAGGTGTGGTCCCACCGAGTCCATCTGTGAAGGATAAGGGGGCGCTGAGTGCAGATCTTA
TAGGGCAAGAAACGCCTGCTTCTCCAGCGCAGAGAAGTCAGAGGCAACAGCCAGATTCTTCTGTTATTGC
TTCAGACCGGGCAAACCTGAGCCCTGACGTAGCCCATGGCGAAGTTGCAGCTAAGTCTAAGAAGGGGGTA
GATAAAGCGGCCCCAATCGGCTCTGGTGCAGACTATAGTGAAGTTGAAGCTGAACTCGAGAAGATTGGTG
CTCTCTCTTCCCGGCAGCCTTCCGTCCCCGCACAAGAGCCCGTACAAGAACCTCGTGTTGGCACAGAAGC
AGCGTTGCGGAAAGCATCGAAGGATAAGGGGACGCTGAGCGCAGATCTTATAGGGCAAAAAACGCCTGCT
TCTCCAGCGCAAAGAAGTCAGAGAAAACAACAGGATTCTTCTGTTATTGCTTCAGACCGGGCAAACTTGA
GCCCTGGCGCAGGCCATGGAGAAGTTGCAGCTAAGTCTAAGAAGAGGGTAGATAAAGCAACCCTAATCAG
AAACCTAATCAGCTCTGGTGCAGACTATAGTGAAGTTGAAGCTGAACTCGAGAAGATTGGTGCTCTCTCT
TCCCGGCAGCCTTCCGTCTCCGTACAGGAGCCCGTACAAGAACCTCGTGTTGGCACAGAAGCAGCGTTGC
GGAAAGCATCGGAAGAGGAGGCTAAAATCTTTAGTGACAGCGTTGTGCGCCTCGCAGAAGGGCGCATACG
CAACTATTTGGAACGTTACAACGCTGGGGAGGAACGTTTGGGCCTCACCAGTGACGCAATAATGTCATAC
AAAAGAGAATTGCAGCAGAAGGCCCGAGAGAATGGCAGGGAGTTTACCGAGACGGAGAATACCATGCTCT
GGGCATGTGTGAATATGGCTGCACTTAACCCGGATGCCGCTGCGTCTCGTGAGTTTGCGCGACAAGTTAA
TTTGAGCCACGATAAAAGAGTTGCTAAACTGCAACCGCGTGATCAGACGCGGTGGGATGATCCCGCAACT
CGGGACCCGAATAGAGCCGAGTTCTTTTTCCCCACTCCGAAGAGTATAAGAGGTCTGCCAGGTGCGGACA
AATATCCGCGCACCCTAGCGCGGCTGTTTCCTAACCCCGAAGCGGAAACTCCTTGGGCGCTTGAGAGTGC
CGGGAGGAAGCTTGTTGCGCACATAAAAGCGGGGCTTGATGTAGATACATTCGATCCTAGCGCGCCGATA
GTTGGGAAGCCTGATGCGCCTGAACAGCCACCGATCCCGACCGGGGGGTGGAGTAAACAAGAGCAAAGAA
AGATGGTGGACGGCTTCCTCAAAGATATGGAGAAGGCGATGGACGCAACGCGCGAGGCGGTGCTTCGGAG
TAATAAAGAAAGGGCGAAGCAACGCGAACAACGGGATGCGCAGTTCAGAAATAAAATCACTCAGCAAAGC
ATTGAAGCATCTATACGTTCTCTAGAGCGCCACGGAGTTACAGTTAATGATGAAGCCAGGAAGGCCATTG
TGGAGCGAGAGACGGCTATCGCGGAAAGGGTACAGGTACGCGAAAACGTGCGGCGTGCAAAAGTGCGTGA
AGAAGTGCGGCGCGCAGACGCGGAATTGCGCAAATTGACGGGGGTTGGCGAAACGGAAAGTGCGTTCGCG
AAAATGGGCGAAATGGGGGTGGCGTCATCGCTTACGCCTGACTTCTACGAGCGCGCGAAAGTTAGCAAAG
GGGCACGCGCAGCGACGGGGATGGCCGAAACGAAAGAGGTGTCACCGCCTGCGCCTGGCTTCTTTCAACG
CATGCAGAAACTAATGCAGCATGTTGTCACAAGAGTAGTATCAAAATTTTTCAATAAACACGCGGAGCAG
CCCCTAGCCGATCAAGTCGCAAGTGCCGTAGATAATGTCAAAGCCCAGCTCCGTACTGATGATACCAGCA
AGACTGTTGAGGCGGGCGTGAAGCAGGAGAAAGCTGATCTGCTTGCAAAGGATCCACTCGCGAAAGCTGC
TGACCCGCTTACAAAAACTGACCGGCGTGCAAAAACTGCTGACCCGCTTGCAAAAACAACTGACCAGCTT
GTGAAAACCGATAATACATTTGCGGAGCGTACTGCCGAGGTCCAAGCAGAGCTGGAAGTTGCGGGTGTTA
GATTCAGCGGGCAGCAACCAGGCGTTGCCGTAGACATAAGCGACATGTCTGCTACCGCTAATTCCAGACA
GCAGCAGAGTGCCAGTGAGCGGGTGGGGCAGAGGCCCACGTTGGAAAGCGCCGTAAGGGAATTTGCAAAT
GCGGTGGATGCCGCTTCAAAGTTGGAGCAGCGCACGGCACGGCAGCAACCCGCGATACAACAGCCACAAA
GCGCGCGTGGTAGATAA
 Primer design

Reference
(1) Lockwood S; Voth DE; Brayton KA; Beare PA; Brown WC; Heinzen RA; Broschat SL (2011). Identification of Anaplasma marginale type IV secretion system effector proteins. PLoS One. 6(11):e27724. [PudMed:22140462] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature