SecReT4
Effector Protein ID: 56416853
T4SS name [ID]VirB [496]
Gene symbolankA
Locus tagAM705
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]640456..644619 [+]
Productankyrin
Effector typeProtein
DescriptonAnkA
T4CP requirementT4CP Depedent
Target/EffectionUnknown
UniProt IDQ5PAK8
KEGG IDama:AM705
PDB IDNA
Domain hit(s) vs Pfam Ank_2 [PF12796], Evalue: 8.1e-44, Aligned region: 120..163
Ank_2 [PF12796], Evalue: 8.1e-44, Aligned region: 361..491
Ank_2 [PF12796], Evalue: 8.1e-44, Aligned region: 589..703
Ank_2 [PF12796], Evalue: 8.1e-44, Aligned region: 665..733
Ank_2 [PF12796], Evalue: 8.1e-44, Aligned region: 746..787
Ank_5 [PF13857], Evalue: 1.9e-35, Aligned region: 120..158
Ank_5 [PF13857], Evalue: 1.9e-35, Aligned region: 459..495
Ank_5 [PF13857], Evalue: 1.9e-35, Aligned region: 690..731
Ank_4 [PF13637], Evalue: 4.1e-35, Aligned region: 122..165
Ank_4 [PF13637], Evalue: 4.1e-35, Aligned region: 446..489
Ank_4 [PF13637], Evalue: 4.1e-35, Aligned region: 693..733
Ank [PF00023], Evalue: 6.6e-31, Aligned region: 121..150
Ank [PF00023], Evalue: 6.6e-31, Aligned region: 688..721
Ank_3 [PF13606], Evalue: 2.4e-28, Aligned region: 121..147
Protein Sequence: 1387 a.a.     [Download]
>gi|56416853|ref|YP_153927.1| ankyrin [Anaplasma marginale str. St. Maries]
MSEESLMASPGSRSSGPRTSARKEGELGSADDTHEGLNKGLNNGASEHGEAVLESAVPTTPTPTPTPSPG
VPPLQPREEARRILTYAWGNMQRDEYAEFVAQLADVPQGYEDTWLLESDLKTILHHACSAGDPKYVSYLL
NHGYSISAVDIQANTPLHDAATALDGQSAARLQLILEHLGYGHPTARATNLKGEAPLHSAIACENLENVK
KFVELSDCSLLDLESQTFLHRAARNQGDEFTSHVLEHVKAQVAASKDIAKHYKALLCSEDLSGYLPAHYA
ATRGLQNSGINILQETIAQARMSGGNTGVSNVLQHMGGAGNTILNCATKGKCRPLLEEAVKIYAQHCQAG
FSIQDEQGRAPIHNAAGYASADLFAKILHNTNTQAFDKHTQDGANLLSLVMQDKADRTRRQGKIKLCLDV
PEIAQWINTPGLNGMVPLCEMYLEGNSVEYITDLIKSDKVDVDSRCKDGRSVIHIAAERGDVKVLEALLL
SRKNAKGNAKFPVSEGQCTPAVHVLQTRGDDDATLEVIKRLIPQEPSLEDVALHAARSGNYRVLRYVTDC
TQGHGGIDVNSELRDAKGNVVSICGELLRNGHINIVSKLVKTQGARLEGIDSQCALSSAIQGNCFTNNRG
NIAGYNWFEQLMALFTGLTDMVREIFTKGIAIERAIKLLLQNGAEIRGYEVEKTALGDDDTPLIFAIKHA
QPDTTLVRFLIRNGADVNCRDSSGNTALHAAVELLKFPEKQKCAQEFVDLLCARGASARQRNAQGHTPLH
MAAAYRSIPAFESILRSNKLSALERSSVDGSSALHVAMKSGVGESDIMRMLKSCQQILAPVELAQMLSTH
DSSGNTLMHVAAKLDFKDVVAFGLNNGAQMSIKNAEGKLAHELAPPSGHIAGGKLASKMATQVNSEGGAR
SYSTVTVDPLGRTSRARRNVRTPAPKAGSIAGRIPAAAAGGAANDDNKNRGTGPSGPGSTGSPSQGGSGV
PGAYGPDAKAASAYGAHAQDIHQPSAPGLDTPGDAAVCSGGHGHPTTHLWSSANTPAAPHPGTSADSTTP
PPYASIFGTPTTDTEDTAYTRPAVTLYPKIGGSGSPTPAAAGTAAQDVQRALHTDTALDEREEQERGYDR
TQYSTEEALESAIDALGVDSLSGLVGMFSSAAQQLEQCKDGKQQPLKAAAEVAGSETLADAAKRLLSALG
SITAASDQEKTGRAADQRAAEAAESGVASDAQQQAHGASSQSTGQKQQDGTTQEQGTAEMAAPATTEQVV
IGGLSRLAAAAQSSLRAHSGTTAEGKQEQKTKATAASSALNATGTAAGKAKSGVASDAPQQAHGAASQST
GQKPKDAKLSTEVEGAVKVLADSINQAENDMAAASSTSQQPAGKQPTAPTKYLSRGW
-
Nucleotide Sequence: 4164 bp     [Download]
>gi|56416370|ref|NC_004842.2|:640456-644619 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTCTGAAGAATCTCTCATGGCTTCTCCTGGATCTCGATCATCTGGACCGAGGACTTCTGCACGCAAAG
AGGGGGAGCTCGGTTCCGCTGATGATACACACGAAGGTTTGAACAAAGGTTTGAACAACGGGGCTTCTGA
GCACGGAGAAGCAGTACTGGAGAGTGCTGTACCCACTACGCCAACACCGACACCGACGCCGTCGCCAGGC
GTGCCGCCACTGCAGCCACGAGAGGAAGCTAGGCGTATCCTGACCTATGCGTGGGGCAATATGCAGCGCG
ACGAGTACGCGGAGTTTGTAGCGCAACTTGCGGACGTGCCTCAGGGGTACGAGGATACTTGGCTACTCGA
ATCGGACCTAAAGACAATACTGCACCATGCGTGCTCCGCGGGAGATCCCAAATACGTTAGCTACTTGCTG
AATCATGGATACAGCATATCAGCCGTTGACATTCAGGCAAATACGCCCCTGCATGACGCGGCAACCGCGC
TGGACGGTCAGTCCGCGGCCAGGTTGCAGCTGATTCTGGAACATCTTGGGTACGGGCACCCCACTGCAAG
AGCGACCAATCTTAAAGGTGAGGCACCTCTGCACTCTGCGATTGCCTGTGAGAATCTAGAAAATGTAAAG
AAGTTCGTTGAGCTCAGCGACTGCAGCCTGCTTGATTTAGAATCGCAAACATTTCTACACCGAGCGGCAC
GGAACCAAGGCGATGAATTCACGTCACACGTTCTGGAGCATGTGAAAGCACAAGTTGCAGCATCGAAAGA
CATTGCAAAACACTACAAGGCGCTGTTATGCTCTGAGGACCTGAGTGGTTACCTGCCAGCGCACTATGCG
GCCACACGTGGACTGCAAAACTCTGGTATTAACATACTCCAAGAAACCATCGCGCAGGCACGGATGAGCG
GTGGGAACACCGGTGTCAGCAACGTCCTGCAGCACATGGGTGGCGCCGGCAATACAATTCTGAACTGTGC
AACAAAAGGTAAGTGCAGACCACTGCTGGAGGAAGCAGTTAAGATTTATGCGCAACACTGCCAAGCCGGA
TTCTCAATCCAAGATGAACAAGGCAGGGCACCCATCCACAACGCAGCTGGGTACGCTAGCGCGGACCTTT
TTGCGAAAATACTTCACAATACAAACACTCAGGCTTTCGATAAGCATACACAAGACGGTGCAAACCTGCT
AAGCCTCGTAATGCAGGATAAAGCAGATCGCACCAGACGGCAGGGGAAAATAAAGCTGTGTCTGGACGTT
CCCGAAATCGCACAGTGGATAAACACTCCGGGCCTGAATGGTATGGTCCCACTATGTGAGATGTACCTGG
AAGGCAACAGCGTAGAGTATATAACAGACCTGATAAAGAGCGATAAAGTAGACGTAGATAGCCGATGCAA
AGATGGCAGGTCTGTGATACACATTGCAGCGGAAAGAGGCGATGTTAAGGTCTTGGAAGCACTGCTACTG
AGCAGGAAGAACGCAAAAGGAAATGCAAAATTCCCTGTATCTGAGGGCCAATGTACTCCTGCAGTTCACG
TGCTACAAACCAGGGGCGACGATGACGCTACCCTTGAAGTTATCAAGCGATTGATTCCCCAAGAGCCCTC
CTTGGAAGATGTGGCACTCCATGCTGCGCGCTCCGGGAATTATCGTGTACTGCGATATGTGACTGACTGT
ACACAAGGGCACGGTGGGATTGATGTCAACAGCGAGCTTAGAGACGCCAAAGGGAACGTTGTTAGCATCT
GCGGTGAGCTGCTGAGGAACGGGCATATTAATATAGTAAGCAAATTGGTCAAGACCCAGGGCGCAAGACT
CGAGGGGATTGACAGCCAGTGTGCCTTGTCCTCTGCAATTCAGGGGAACTGTTTTACAAACAATCGGGGA
AATATCGCCGGCTACAACTGGTTTGAACAGCTCATGGCGCTGTTCACAGGACTTACAGATATGGTCCGCG
AGATTTTCACCAAGGGCATCGCAATCGAGCGTGCCATAAAACTTCTCCTGCAAAACGGCGCTGAGATTCG
TGGCTATGAAGTGGAAAAAACCGCACTCGGGGATGACGATACACCATTGATCTTCGCAATAAAACACGCG
CAGCCGGATACGACCTTGGTTCGGTTCCTGATTAGAAATGGGGCTGACGTAAATTGCCGCGATAGCTCCG
GAAATACTGCGCTGCATGCCGCAGTTGAACTGTTAAAATTCCCTGAAAAGCAGAAATGCGCTCAAGAGTT
TGTGGACCTGCTTTGCGCCCGTGGTGCCTCTGCTCGCCAGCGCAATGCTCAGGGCCATACTCCACTGCAC
ATGGCAGCTGCGTACAGGAGTATACCCGCATTTGAGAGCATATTGAGGAGCAACAAGCTCAGTGCACTGG
AGCGCTCCAGCGTTGATGGGTCTTCGGCGCTACACGTTGCCATGAAGAGCGGCGTGGGTGAAAGTGACAT
TATGAGAATGCTGAAGAGCTGCCAGCAAATTTTAGCTCCAGTTGAGCTTGCACAGATGTTGAGCACACAT
GATTCAAGCGGCAACACCCTGATGCATGTTGCTGCGAAGCTGGATTTCAAAGATGTCGTGGCGTTTGGCC
TGAACAATGGCGCACAGATGTCTATTAAAAACGCAGAGGGTAAACTTGCTCACGAGCTAGCTCCACCATC
AGGCCACATAGCGGGCGGCAAGTTAGCTAGCAAGATGGCCACACAGGTCAACAGCGAGGGAGGAGCTCGT
AGCTACAGCACAGTTACAGTAGATCCTTTAGGGCGTACCAGTCGTGCAAGACGCAATGTACGAACCCCTG
CACCCAAAGCTGGTAGCATCGCAGGCAGGATTCCTGCTGCCGCAGCAGGCGGTGCAGCAAATGATGATAA
CAAAAACAGGGGTACTGGGCCTTCGGGTCCCGGTAGCACTGGCAGTCCATCGCAGGGTGGCAGCGGCGTG
CCTGGGGCCTACGGCCCCGACGCGAAAGCGGCAAGTGCGTATGGTGCACATGCACAAGATATTCATCAAC
CTAGCGCCCCCGGCCTTGACACTCCTGGCGATGCAGCGGTATGCTCTGGTGGTCATGGACACCCTACAAC
TCACCTATGGAGTAGTGCTAATACACCCGCAGCACCGCATCCGGGTACAAGTGCTGACAGTACAACACCT
CCGCCATATGCGTCTATTTTCGGCACTCCTACCACAGACACAGAAGATACGGCGTACACACGGCCAGCTG
TAACATTATATCCGAAGATAGGCGGTTCCGGTTCACCTACCCCAGCTGCAGCTGGCACTGCAGCTCAGGA
TGTGCAGAGAGCTCTGCATACAGACACCGCACTTGATGAAAGAGAGGAGCAGGAACGTGGATACGATAGG
ACGCAATACAGTACTGAGGAAGCCCTAGAGAGTGCCATAGACGCTCTTGGTGTTGATAGTCTATCAGGGC
TGGTAGGTATGTTCTCTTCAGCAGCGCAGCAGCTGGAACAGTGTAAGGATGGAAAGCAACAGCCCCTCAA
AGCCGCTGCGGAAGTAGCAGGCTCAGAAACACTGGCAGATGCGGCAAAGCGGCTTCTGAGTGCTCTTGGT
AGCATAACAGCAGCAAGCGATCAGGAAAAAACAGGAAGAGCTGCGGATCAACGAGCGGCAGAGGCGGCAG
AAAGCGGCGTGGCAAGCGATGCTCAACAACAAGCACACGGTGCTTCATCGCAATCTACGGGGCAGAAACA
GCAAGACGGCACTACACAGGAACAAGGCACAGCGGAAATGGCCGCTCCAGCAACAACCGAACAAGTTGTT
ATCGGCGGTCTAAGCAGGCTAGCAGCAGCGGCACAATCATCCTTGCGTGCTCATAGCGGAACAACTGCAG
AAGGCAAGCAAGAACAAAAAACAAAGGCCACTGCGGCATCATCGGCGCTGAATGCTACTGGTACCGCTGC
TGGAAAGGCAAAGAGCGGTGTGGCGAGCGATGCCCCACAACAAGCACATGGCGCTGCATCGCAATCTACA
GGGCAGAAGCCGAAGGATGCAAAGCTTAGCACCGAAGTTGAAGGCGCAGTAAAAGTACTTGCCGATTCCA
TCAATCAAGCAGAGAACGATATGGCGGCGGCGAGCAGTACCTCACAACAACCAGCAGGTAAACAACCTAC
AGCACCTACAAAATACCTGTCCAGAGGCTGGTAA
 Primer design

Reference
(1) Lockwood S; Voth DE; Brayton KA; Beare PA; Brown WC; Heinzen RA; Broschat SL (2011). Identification of Anaplasma marginale type IV secretion system effector proteins. PLoS One. 6(11):e27724. [PudMed:22140462] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature