SecReT6
Protein ID: 104779794
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0529
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]547047..548567 [+]
Productsigma-54 dependent transcriptional regulator
NoteSfa2
UniProt IDQ1IFS7
KEGG IDpen:PSEEN0529
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 6.60E-71, Aligned region: 196..363
Sigma54_activ_2 [PF14532], Evalue: 3.70E-23, Aligned region: 197..367
HTH_8 [PF02954], Evalue: 5.00E-13, Aligned region: 350..360
HTH_8 [PF02954], Evalue: 5.00E-13, Aligned region: 457..496
GAF_3 [PF13492], Evalue: 2.50E-07, Aligned region: 31..151
GAF_3 [PF13492], Evalue: 2.50E-07, Aligned region: 202..255
GAF_2 [PF13185], Evalue: 1.00E-06, Aligned region: 31..151
GAF_2 [PF13185], Evalue: 1.00E-06, Aligned region: 203..276
AAA_5 [PF07728], Evalue: 1.10E-05, Aligned region: 220..338
HTH_30 [PF13556], Evalue: 6.30E-05, Aligned region: 453..469
HTH_30 [PF13556], Evalue: 6.30E-05, Aligned region: 466..498
GAF [PF01590], Evalue: 7.00E-05, Aligned region: 29..147
GAF [PF01590], Evalue: 7.00E-05, Aligned region: 255..255
GAF [PF01590], Evalue: 7.00E-05, Aligned region: 421..453
AAA_16 [PF13191], Evalue: 0.0054, Aligned region: 214..259
Protein Sequence: 506 a.a.     [Download]
>gi|104779794|ref|YP_606292.1| sigma-54 dependent transcriptional regulator [Pseudomonas entomophila L48]
MFAHVPHPLAYAETLLGTFTDLARAADDQCLLQALVQAVAGLSGCPLVQVYLLDPTHTRLGLEAAWLDGK
LLARDCSSLPADYNGEQLLQFALCQNRVVNIAELSASLFDTSFLPCQNTPWQALLAVPLVTAQQRVAGVL
LCVNRERGALDGFADSLGRLGGFAMGQLQLLRRLRQPGPQPQATSPAPIAASSYGLIGQSQAMRQTCQMI
SKVLHSPYTVLLRGETGTGKELVARAIHDYGPRRSGAFVVQNCAAFPESLLESELFGYRKGAFTGADRDR
PGLFDAADGGTLLLDEIGDMPLALQAKLLRVLQEGEIRPLGSNVTHKIDVRIIAATHRDLAQMVSDGLFR
EDLYYRLAQFPIELPPLRQRNGDVITLARHFCDKACDFLQRSPVGWSQAALDHLDGYAFPGNVRELKGLV
ERAVLLCEGDELEVGHFALNLAEPPLEDSELNLRERLEKVERRLLLDCLRKHDGNQTLAARELGLPRRTL
LYRLGRLNIQIGDCEG
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|104779316|ref|NC_008027.1|:547047-548567 Pseudomonas entomophila L48 chromosome, complete genome
ATGTTCGCGCACGTGCCGCACCCGCTGGCCTATGCCGAGACGCTGCTGGGCACCTTCACCGACCTGGCCC
GGGCGGCGGACGACCAGTGCCTGTTGCAGGCGCTGGTGCAGGCCGTGGCCGGGCTCAGCGGTTGCCCGCT
GGTGCAGGTGTACCTGCTCGACCCGACCCATACCCGGCTCGGGCTCGAAGCCGCCTGGCTCGACGGCAAG
CTGCTGGCGCGCGACTGCTCCAGCCTGCCGGCCGACTACAACGGCGAGCAGCTGTTGCAGTTCGCCCTGT
GCCAGAACCGTGTGGTGAACATCGCCGAACTGTCCGCCAGCCTGTTTGACACCAGCTTCCTGCCTTGCCA
GAACACGCCCTGGCAGGCGCTGCTGGCGGTGCCATTGGTGACCGCGCAGCAGCGTGTCGCCGGGGTGTTG
CTGTGCGTGAACCGCGAGCGCGGCGCGCTGGACGGTTTCGCCGACTCACTCGGCCGCCTGGGTGGTTTCG
CCATGGGCCAGTTGCAGCTGTTGCGCCGCCTGCGCCAGCCCGGGCCACAACCCCAGGCAACCAGCCCGGC
GCCGATCGCCGCCAGCAGCTATGGCCTGATCGGCCAGAGCCAGGCCATGCGCCAGACCTGCCAGATGATC
AGCAAGGTCCTGCACAGCCCCTACACTGTGTTGCTGCGCGGCGAGACTGGCACCGGCAAGGAGCTGGTGG
CCCGCGCCATCCACGACTACGGCCCGCGTCGCTCGGGCGCGTTCGTGGTGCAGAACTGTGCGGCGTTTCC
CGAGAGCCTGCTGGAGAGCGAACTGTTCGGTTATCGCAAGGGTGCCTTCACCGGTGCCGATCGCGACCGC
CCCGGGCTGTTCGATGCCGCCGACGGCGGCACCCTGCTGCTCGACGAGATCGGCGACATGCCCCTGGCCC
TGCAGGCCAAGCTGTTGCGCGTGCTGCAGGAAGGCGAGATCCGCCCGCTGGGCTCCAATGTCACCCACAA
GATCGACGTGCGCATCATCGCCGCGACTCACCGTGACCTGGCGCAGATGGTCAGCGACGGCCTGTTCCGC
GAAGACCTGTACTACCGCCTGGCGCAGTTCCCCATCGAGCTGCCACCGCTGCGCCAACGCAACGGCGATG
TCATCACCCTGGCCCGGCACTTCTGCGACAAGGCCTGCGACTTCCTCCAACGCAGCCCGGTGGGCTGGTC
CCAGGCTGCCCTGGATCACCTCGACGGCTATGCCTTCCCCGGCAACGTGCGCGAGCTCAAGGGCCTGGTG
GAGCGCGCGGTGCTGCTGTGCGAGGGCGATGAGCTGGAAGTCGGTCACTTCGCCTTGAACCTGGCCGAGC
CACCGCTGGAGGACAGCGAGCTGAACCTGCGCGAGCGCCTGGAAAAGGTCGAGCGCCGCCTGCTGCTCGA
CTGCCTGCGCAAGCACGACGGCAACCAGACCCTGGCAGCCCGCGAGCTCGGCCTGCCGCGGCGCACCCTG
CTGTACCGGCTGGGGCGCCTGAACATCCAGATCGGCGATTGCGAGGGCTGA
 Primer design