SecReT6
Protein ID: 104779800
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0535
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]552718..556245 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ1IFS1
KEGG IDpen:PSEEN0535
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.30E-80, Aligned region: 240..337
IcmF-related [PF06761], Evalue: 5.30E-80, Aligned region: 495..785
IcmF-related [PF06761], Evalue: 5.30E-80, Aligned region: 854..902
ImcF-related_N [PF14331], Evalue: 9.00E-73, Aligned region: 195..448
DUF1215 [PF06744], Evalue: 4.00E-35, Aligned region: 910..1034
DUF4131 [PF13567], Evalue: 0.0018, Aligned region: 14..86
DUF4131 [PF13567], Evalue: 0.0018, Aligned region: 440..461
AAA_16 [PF13191], Evalue: 0.0042, Aligned region: 132..267
AAA_16 [PF13191], Evalue: 0.0042, Aligned region: 788..883
Protein Sequence: 1175 a.a.     [Download]
>gi|104779800|ref|YP_606298.1| hypothetical protein PSEEN0535 [Pseudomonas entomophila L48]
MKNFFKKVGAFLAKTWVWSLLLVLALALLVWFAGPLLAVADNKFWEDAAARLLTISVLFLLWGLWMVFAS
WRANNRKQAELESEDGRERLEREERKEEEGKEIKARFKHALSTLKHSSLYGGRSERWRRDLPWYLVLGPQ
GAGKTSLIDHSGLEFPINALERKLARDPSNGDFCDFYFAEQAVLVDTAGRFLNQSDSEIDGSAWRVMLDQ
LRLRRRNRPLNGVVVTVPLDTLLGGEAAVNDLAQKVRSRLQELRQRLHVEVPVYLVLSKTDRLQGFDAFF
DQQSREENEQVFGITFGKGQNGADTELLAKEFQGLLQRLGDQVTQRMHHERNTLRRARILDFPHQLGRIG
DQLCLFVDAAFTGNRYQRASQLRGFYLTSAPHQAPQVDSDNGYHPGQPGRAAPQGRSRFILQLFSRVIFP
EYDLAGLDQRERRRIHWGQRAVYLGALAALALFGVLWAGSFSGNHERLEQVRELGQQWHRQHVGLGARDD
ALAALKPLDTAWQASRVFPERSDASWLHRGGLYQGVPANEVLQPAYQRELETLLLPRVAQMVEGQIRGNL
KSRERLLNSLRAYLMLGMPDRRDQGWLKDWVAAGWSQQYPGNTAVQEGLNAHFGRLLEQPFAYPLNDALV
VQARQVLRAESLASVVYRVLREQARSLPEYRLSQQLGPQASQFVGIDYPIPGFYTSQGYQQYFSVQGANL
VNDILRDNWVLGEGSGISDMDMRRLMVELEQLYFRDYANYWGEAINQVGLIPFNDAGESADQLSALTAAN
SPLLLLLTEVRENTRFPVLAETPDEGNQAAEAAAGKAAAKKLGKGGAAVAGAVADKARDALAKKPLPDTA
RMALQRRFEPLHRLLDDNNGPGPDLAPTMQALNDLQQQMAGLARSNQAEEASYQMAKARMSGQRDALSSL
RNGTARLPRPVAGWFNLLSDDIWRMVLNDTYSYLNQRYQSELYSFYGRAIESRYPFNAHGTSDVAISDFR
DFFKAQGVADRFFDTYMRPFVSGEAGTFRLRSLDGQSLPMARAYLEQMGAAQTIRQSFFAQNPEEPQVQF
KLEPYTLDPSVSRAEFRFGDTVIDYRHGPIVSTSLKWPTEAQDGNSSLTLEQLNGRPMALEKNGGPWSLF
RLLDLMQTEYLKGRDTMVLKANVGGMRANYLLTSQRAPNPFDMNVLRGFRLPGEL
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|104779316|ref|NC_008027.1|:552718-556245 Pseudomonas entomophila L48 chromosome, complete genome
ATGAAGAATTTTTTCAAGAAAGTCGGCGCCTTCCTCGCCAAGACCTGGGTCTGGAGCCTGCTGCTGGTGC
TGGCCCTGGCCTTGCTGGTGTGGTTCGCCGGGCCGCTGCTGGCGGTGGCCGACAACAAGTTCTGGGAAGA
CGCCGCAGCGCGCCTGCTGACCATCAGCGTGCTGTTCCTGCTGTGGGGCTTGTGGATGGTGTTCGCCAGC
TGGCGCGCCAACAACCGCAAGCAAGCCGAGCTTGAGAGCGAGGATGGTCGCGAGCGCCTGGAGCGTGAAG
AGCGCAAGGAAGAGGAGGGCAAGGAGATCAAGGCCCGCTTCAAGCATGCCTTGTCCACCCTCAAGCATTC
GAGCCTCTACGGTGGCCGCAGTGAACGCTGGCGCCGTGACTTGCCCTGGTACCTGGTGCTCGGCCCACAG
GGCGCGGGCAAGACCAGCCTGATCGACCATTCGGGCCTGGAGTTCCCGATCAACGCGCTGGAGCGCAAGC
TCGCCCGTGATCCGTCCAATGGCGATTTCTGCGACTTCTACTTCGCCGAGCAAGCGGTGCTGGTGGATAC
CGCCGGGCGTTTCCTCAACCAGTCCGATAGCGAGATCGACGGCAGCGCCTGGCGGGTGATGCTCGACCAA
TTGCGCCTGCGCCGGCGCAACCGCCCGCTCAATGGCGTGGTGGTCACCGTGCCGCTGGACACGCTGCTCG
GCGGCGAGGCCGCGGTCAACGATCTGGCGCAGAAAGTCCGTTCGCGCCTGCAGGAGCTGCGCCAGCGCTT
GCACGTCGAGGTGCCGGTGTACCTGGTGCTGAGCAAGACCGACCGCCTGCAAGGCTTCGACGCCTTCTTC
GACCAGCAGTCGCGCGAAGAGAACGAACAGGTGTTCGGCATCACCTTCGGCAAGGGCCAGAACGGCGCCG
ACACCGAGCTGCTGGCCAAGGAATTCCAAGGCCTGCTGCAACGCCTGGGTGACCAGGTCACCCAGCGCAT
GCACCACGAGCGCAACACCCTGCGCCGTGCGCGGATCCTCGACTTCCCGCACCAGCTGGGGCGCATCGGC
GACCAACTGTGCCTGTTCGTCGACGCCGCCTTCACCGGCAACCGTTACCAGCGCGCCAGCCAGCTGCGCG
GCTTCTACCTGACCAGCGCGCCGCACCAGGCGCCGCAGGTGGACAGCGACAATGGTTACCATCCCGGCCA
GCCCGGGCGAGCGGCGCCACAGGGGCGCTCGCGTTTCATCCTGCAGTTGTTCAGCCGGGTGATCTTCCCC
GAGTACGACCTGGCTGGCCTCGACCAGCGCGAACGTCGACGCATCCATTGGGGCCAGCGTGCTGTCTATC
TTGGTGCCCTCGCGGCGCTGGCGCTGTTCGGCGTGCTGTGGGCCGGCAGTTTCTCCGGCAACCATGAACG
CTTGGAACAGGTGCGCGAACTGGGCCAGCAATGGCACCGCCAGCATGTCGGCCTGGGCGCCCGTGACGAC
GCCCTGGCCGCGCTCAAGCCGCTGGACACCGCCTGGCAGGCCTCGCGCGTGTTCCCTGAGCGCAGCGACG
CTTCGTGGCTGCACCGCGGTGGCCTGTACCAGGGCGTGCCGGCCAACGAAGTGCTGCAGCCGGCCTATCA
GCGCGAGCTGGAAACCCTCCTGCTGCCACGGGTGGCGCAGATGGTCGAAGGGCAGATCCGCGGCAACCTG
AAAAGCCGTGAGCGCCTGCTCAACAGCCTGCGCGCCTATCTGATGCTCGGCATGCCCGACCGCCGTGACC
AGGGCTGGCTCAAGGACTGGGTGGCGGCCGGCTGGTCGCAGCAATACCCTGGCAACACCGCCGTGCAGGA
AGGCCTGAACGCTCACTTCGGGCGTCTGCTCGAGCAGCCGTTCGCCTACCCGCTCAACGACGCCTTGGTG
GTCCAGGCGCGCCAAGTGCTGCGCGCCGAGTCCCTGGCCAGCGTGGTCTACCGGGTATTGCGCGAACAGG
CCCGCAGCCTGCCGGAGTACCGCCTGAGCCAGCAGCTCGGGCCGCAGGCCAGCCAGTTCGTTGGTATCGA
CTACCCGATCCCCGGCTTCTACACCTCCCAGGGTTACCAGCAGTACTTCTCGGTGCAGGGCGCCAACCTG
GTCAACGACATCCTGCGCGACAACTGGGTGCTGGGCGAGGGCAGCGGCATCAGCGACATGGACATGCGCC
GGTTGATGGTCGAGTTGGAGCAGCTGTACTTCCGCGACTACGCCAACTACTGGGGCGAGGCGATCAACCA
GGTCGGCCTGATCCCGTTCAACGACGCGGGCGAAAGCGCCGACCAGCTGTCGGCGCTGACCGCCGCCAAC
TCGCCGTTGCTGCTGCTGCTCACCGAGGTGCGCGAGAACACCCGCTTCCCGGTGCTGGCGGAAACCCCGG
ACGAAGGCAACCAGGCGGCCGAGGCCGCGGCTGGCAAAGCCGCTGCCAAGAAGCTCGGCAAGGGCGGCGC
GGCAGTGGCCGGCGCCGTGGCCGACAAGGCCCGCGATGCCCTGGCCAAGAAACCACTGCCGGACACCGCG
CGCATGGCCCTGCAACGGCGCTTCGAGCCGCTGCACCGGTTGCTCGACGACAACAACGGCCCGGGCCCCG
ACCTGGCGCCGACCATGCAGGCGCTGAACGACCTGCAGCAGCAGATGGCCGGCCTGGCTCGTTCCAACCA
GGCCGAGGAAGCCTCGTACCAGATGGCCAAGGCGCGCATGTCGGGCCAGCGCGATGCCCTGAGCAGCCTG
CGCAACGGCACTGCGCGCCTGCCACGGCCAGTGGCCGGCTGGTTCAACCTGCTGTCCGACGACATCTGGC
GCATGGTGCTCAACGACACCTACAGCTACCTCAACCAGCGCTACCAGAGCGAGCTGTACAGCTTCTATGG
CCGCGCCATCGAGTCGCGCTACCCGTTCAACGCCCATGGCACCAGCGACGTGGCGATCAGCGACTTCCGC
GACTTCTTCAAGGCCCAGGGCGTGGCGGACCGCTTCTTCGACACCTACATGCGCCCGTTCGTCAGCGGTG
AAGCCGGCACCTTCCGCCTGCGCAGCCTCGATGGCCAGAGCCTGCCGATGGCCAGGGCGTACCTGGAGCA
GATGGGCGCGGCCCAGACCATCCGCCAGAGCTTCTTCGCGCAGAACCCGGAAGAGCCGCAGGTGCAGTTC
AAGCTCGAACCGTACACCCTCGACCCGTCGGTGAGCCGCGCCGAGTTCCGCTTCGGCGACACGGTGATCG
ACTACCGCCATGGCCCGATCGTCTCCACCAGCCTGAAGTGGCCGACCGAGGCCCAGGACGGCAACAGCAG
CCTGACCCTGGAGCAGCTCAACGGCCGCCCCATGGCGCTGGAGAAGAACGGCGGCCCGTGGTCGCTGTTC
CGCCTGCTCGACCTGATGCAGACCGAGTACCTCAAGGGCCGCGACACCATGGTGCTCAAGGCCAATGTCG
GCGGCATGCGCGCCAACTACCTGCTGACCAGCCAGCGCGCGCCGAACCCGTTCGACATGAACGTGCTGCG
CGGCTTCCGCCTGCCAGGGGAGCTGTGA
 Primer design