SecReT6
Protein ID: 104779801
SecReT6 ID125
T6SS typei1
Gene symbolstp1
Locus tagPSEEN0536
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]556245..556973 [+]
ProductSerine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDQ1IFS0
KEGG IDpen:PSEEN0536
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 2.50E-16, Aligned region: 19..203
PP2C [PF00481], Evalue: 2.70E-15, Aligned region: 31..202
SpoIIE [PF07228], Evalue: 2.90E-09, Aligned region: 36..241
Protein Sequence: 242 a.a.     [Download]
>gi|104779801|ref|YP_606299.1| Serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas entomophila L48]
MQPATPWRSAARTDPGKVRARNEDAFLDCPQQGLWAVADGMGGHEAGDVASQMIVESLAELPASSTFDER
VVAVRQCLHWINRRLGQELTVSVEGQARIIGSTVVTLLLEGRRGACVWAGDSRCYLWRGQRLYQLTRDHS
LQQQLIDKERMSAEQAREHPSARALTRAVGASASLTLEVLEFEACPGDVFLLCSDGLYDGVESGGLGHAL
DLASPGEALQRLFETALGGSAKDNLTAVVIHR
 
Nucleotide Sequence: 729 bp     [Download]
>gi|104779316|ref|NC_008027.1|:556245-556973 Pseudomonas entomophila L48 chromosome, complete genome
ATGCAGCCTGCCACCCCCTGGCGCAGCGCGGCGCGCACCGACCCGGGCAAGGTCCGTGCGCGCAACGAGG
ACGCCTTTCTCGACTGCCCGCAGCAGGGGCTGTGGGCAGTCGCCGATGGCATGGGCGGCCACGAGGCTGG
CGATGTCGCCAGCCAGATGATCGTCGAGAGCCTGGCCGAACTGCCGGCCAGCAGCACGTTCGACGAGCGC
GTGGTCGCCGTGCGCCAGTGCCTGCACTGGATCAACCGCCGGCTTGGTCAGGAGCTCACCGTGAGTGTCG
AAGGCCAGGCGCGGATCATCGGCAGCACCGTGGTCACCCTGCTGCTCGAAGGCCGCCGTGGCGCTTGCGT
GTGGGCCGGCGACAGCCGCTGCTACCTGTGGCGTGGCCAGCGCCTGTACCAGCTGACCCGTGACCACTCG
CTGCAGCAGCAACTGATCGACAAGGAGCGCATGAGCGCCGAGCAGGCCCGTGAGCACCCTTCGGCGCGGG
CCTTGACCCGTGCCGTCGGCGCCAGCGCCAGCCTGACCCTGGAAGTGCTGGAGTTCGAGGCGTGCCCAGG
TGATGTGTTCCTGCTGTGCAGCGACGGCCTGTACGACGGCGTGGAGAGCGGTGGCCTGGGCCATGCGCTG
GACCTGGCCTCGCCCGGCGAAGCCCTGCAACGCCTGTTCGAAACCGCCCTGGGCGGTTCGGCGAAAGACA
ACCTGACCGCAGTGGTGATCCACCGATGA
 Primer design