SecReT6
Protein ID: 104779802
SecReT6 ID125
T6SS typei1
Gene symbolstk1
Locus tagPSEEN0537
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]556970..558028 [+]
ProductSerine-threonine kinase Stk1
NoteStk1
UniProt IDQ1IFR9
KEGG IDpen:PSEEN0537
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 7.70E-36, Aligned region: 76..306
Pkinase_Tyr [PF07714], Evalue: 1.20E-22, Aligned region: 78..330
APH [PF01636], Evalue: 0.00011, Aligned region: 178..228
APH [PF01636], Evalue: 0.00011, Aligned region: 256..300
RIO1 [PF01163], Evalue: 0.0013, Aligned region: 182..229
Protein Sequence: 352 a.a.     [Download]
>gi|104779802|ref|YP_606300.1| Serine-threonine kinase Stk1 [Pseudomonas entomophila L48]
MNLGSGDALDVLDALEQDSESTYFAFNQATAPEPARTGKGRRKRRGKGRAPATTQAPAATPVRALPPLPD
VLAGRYRLERLLGAGGMGRVYRARDLLQERFGDPQPLLALKLMSDQLATAPDANALLFNEYALTSRLRHP
NLVRLQGFAVDPESDRGFITMELMRGTSLDRLLCDQPMGLAWAQVREIAVPLLDVLACVHAQGVVHGDLK
PSNVMLTDDGLRLFDFGLGMALEGPLAGLPHLSHGRFEAWTPAYAAPELFEGGTPSTASDLYAVACVLYE
LVTGRHPFDRVLSLKAREQGLQHALRVPENMPAKAWTALRTALVFDPGQRSIGAAQLRDAFAARGFWSRF
GK
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|104779316|ref|NC_008027.1|:556970-558028 Pseudomonas entomophila L48 chromosome, complete genome
ATGAACCTTGGCAGCGGCGACGCGCTGGATGTGCTCGACGCACTCGAGCAGGACAGCGAGTCGACCTATT
TCGCATTCAACCAGGCCACCGCGCCCGAGCCCGCCCGCACCGGCAAGGGCCGGCGCAAACGGCGGGGCAA
GGGGCGGGCGCCTGCTACCACGCAGGCACCGGCCGCCACCCCGGTGCGCGCGCTGCCACCGTTGCCCGAC
GTGCTCGCCGGGCGCTACCGCCTGGAGCGCCTGCTCGGCGCGGGCGGCATGGGCCGGGTGTACCGCGCTC
GCGACCTGTTGCAGGAGCGCTTCGGCGACCCGCAGCCGCTGCTGGCGCTGAAGCTGATGAGCGACCAGTT
GGCCACCGCTCCGGACGCCAACGCCCTGCTGTTCAACGAGTACGCCCTGACCAGCCGTCTGCGCCACCCC
AACCTGGTACGCCTGCAAGGCTTCGCCGTCGACCCGGAGAGCGACCGTGGCTTCATCACCATGGAACTGA
TGCGCGGCACCTCCCTCGACCGCCTGCTCTGCGACCAGCCGATGGGCCTGGCCTGGGCGCAGGTGCGCGA
GATCGCCGTGCCGTTGCTCGATGTGCTCGCCTGCGTGCACGCCCAAGGCGTGGTGCACGGCGACCTCAAG
CCCAGCAACGTGATGCTTACCGACGACGGCCTGCGCCTGTTCGACTTCGGCCTGGGCATGGCCCTGGAAG
GCCCGCTGGCCGGCCTGCCGCACCTGAGCCATGGCCGCTTCGAGGCCTGGACCCCAGCGTATGCCGCGCC
GGAGCTGTTCGAAGGCGGCACCCCAAGCACCGCCAGCGACCTGTATGCGGTGGCCTGCGTGTTGTACGAA
CTGGTCACTGGTCGCCACCCGTTCGACCGCGTGCTGTCGCTCAAGGCCCGAGAGCAGGGCCTGCAGCATG
CGTTGCGGGTGCCGGAGAACATGCCGGCCAAGGCCTGGACGGCGTTGCGCACGGCCCTGGTCTTCGACCC
CGGGCAGCGCAGCATCGGCGCCGCGCAGCTACGCGATGCTTTTGCTGCGCGTGGCTTTTGGTCAAGGTTC
GGCAAGTGA
 Primer design