SecReT6
Protein ID: 107024164
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2620
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2880426..2884370 [+]
ProductImcF-related
NoteTssM
UniProt IDQ1BS87
KEGG IDbcn:Bcen_2620
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 3.30E-52, Aligned region: 498..569
IcmF-related [PF06761], Evalue: 3.30E-52, Aligned region: 630..877
DUF1215 [PF06744], Evalue: 1.50E-29, Aligned region: 1010..1125
Protein Sequence: 1314 a.a.     [Download]
>gi|107024164|ref|YP_622491.1| ImcF-related [Burkholderia cenocepacia AU 1054]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAALAFAAVLALWLVVALWRRWRVKRANQQLG
QVLEEQAETGKIAAPAAAALAPDAKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDDKRDVVAQFDTHFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
SLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDGSALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDIIEDRIEQLEQFRRDKPLSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGTLPVSTNAAGAAPQAGAMLAASGTAPAAAPQQAAAPQGGLYSDAS
PTNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIRSAERMISFYLSRVNDD
DWPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLVAGSYAIPGT
FTREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIA
VQGFTSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFTRSQAGQ
MAAANIDINGNPAEVPMGPIGQEFVGLARIVATHDGTSMLKGYMESLSKVRTRFNVIKNQGDPGPGARQL
MQQTLDGNGSELADSLKLVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASAEVNKVWNAQVYQPF
QSSLATKYPFAANAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTN
GFARWVAPLAGGAAGSAAASAEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGAP
GATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWAQGSVNVSVTMRIISTSQPSAGGG
DQPQQQSLRGLQLPSSVADASAGAAQNATQAGTGTPGAAPAVAAANATNAQRAQ
 
Nucleotide Sequence: 3945 bp     [Download]
>gi|107021562|ref|NC_008060.1|:2880426-2884370 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATCGTCGGGATCGTCGCGCTAGCGG
CCATTCTGTTCATCGTCGCCGACATGCTGCAGCTGCCGCTCCTGTGGGCGGCGCTCGCGTTCGCGGCGGT
CCTCGCGCTGTGGCTCGTCGTCGCGCTATGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAGCTCGGC
CAGGTGCTGGAAGAGCAGGCGGAAACCGGCAAGATCGCCGCACCGGCCGCCGCCGCGCTCGCGCCGGACG
CGAAGACGGCCGACCTCGACGTGCTGCGCACGCGCCTGTCGGATGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCAGCC
GCGGGCAAGAGCAGCGCCGTGCTCAATTCCGGCCTGCAGTTCCCATTCGCGGACAAGAACAGCGCCGTGA
TCCACGGCATCGGCGGCACGCGTAACTGCGACTGGTTCTTCACGACCGAAGGGATCCTGCTCGATACGGC
CGGCCGCTATTCGGTGCACGAGGAAGACCGTAGCGAGTGGCTCGGCTTCCTCGGGCTGCTCAAGCGCTAC
CGTCCGAAGGCGCCGATCAACGGCATCATCGTCACGGCCAGCATCGCCGAACTCACCGGCAATCGCCCCG
AATTCGCGATCAACCTCGCGAAGAACCTCCGTCAGCGCGTTCAGGAGCTGACCGAAAAGCTGGAAGTGTT
CGCGCCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAGTACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAACCCGACGACAAGCGTGACGTCG
TCGCGCAGTTCGACACGCACTTCGAGGAACTCTACGAAGGGCTGAAGGAAATCAGCGTCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCGGGCCAGTTGAGCTTTCCGCTCGAATTCTCGACGATCAAGCCG
TCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCACTGCAGGAAGGCGAAACCAACAGCGCGGCCGCGCAGCGCATCGCGCACCGCTT
CGGCCTCGACGGCAGCGCGCTGCCGAAACCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTGATCTTCGCGGACCGCCAGACGGTGCGCCAGTTCGCGAGCCCGACCAAGACGCGGC
TGCGCTACGCGACCTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTGGGCGGCTGGACCTGGTCGAC
CATCGGCAACCAGCAGCTCGTCGCGAACGTGCAGGCCGACCTCGACAACGTCACGCGCCTGCAGCAGGGC
CGCAACGACCTGCAGTCGCGCCTGCAGGCGATGGACATCATCGAGGACCGGATCGAGCAGCTCGAACAGT
TCCGCCGCGACAAGCCGCTGTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGTCTCGAGCAGCACCTGCT
GACCGAGTACTACAACGGCGTGCGCCAGATCCTGCTGGCCCCGGTGTCGCAGAACCTCGCGTCGTTCATG
AAGGACGTGAACGCGCACCCCGAGCAGCTCGTGCCGATGACGCGCCCGCCTGAATCGGGCGCCGTGCAGG
GCGGCACGCTGCCGGTCTCGACGAACGCGGCAGGAGCCGCGCCGCAAGCGGGCGCCATGCTGGCCGCGTC
CGGCACCGCGCCGGCCGCCGCCCCGCAACAGGCGGCCGCGCCGCAGGGCGGCCTCTACAGCGACGCGTCG
CCGACCAACGTGCAGGACGCGTACAACGCGCTGAAGACCTACCTGATGCTGTCCGACAAGCGTCACGTCG
AACAGGCGCACCTGACCGACCAGCTCGCCCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACAT
GCCGCGCGACGAGATGATCCGGAGCGCCGAGCGCATGATCTCGTTCTACCTGTCGCGCGTGAACGACGAC
GACTGGCCGATGATCGACGCGAACCTCGCGCTCGTCGACCAGACCCGCGAGAACCTGCGCCGCGTCGTGC
GCGGCATGCCGGCCCGCCAGCGCGTCTACGAGGAAATCAAGGCCCGCGCGTCGACCCGCTTCGCGCCGAT
GACCATCGCGCGCATCGTCGGCGACGGCAACCAGGGGCTCGTGGCAGGCAGCTATGCGATTCCGGGCACG
TTCACGCGCGAAGCGTGGTTCGACTACGTGCAGCCGGCGATCCGCGATGCGGCGACCAAGGAGCTGCAGG
CGAAGGACTGGGTGCTCAACACGTCGACGCAGGACGACCTGACGCTCGAGGGCAGCCCCGAGCAGATCCA
GAAGACGCTCGTCGGCATGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCG
GTACAGGGCTTCACCAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTCGGCGACCCGCAGGATTCGC
CGATCCGCAAGATCCTCGAGACCGCGTACGACCAGACGTCGTGGGACAACCCGTCGCTCGCGAACGTGAC
GATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAACTGTTCACGCGCTCGCAGGCCGGCCAG
ATGGCGGCAGCCAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAAT
TCGTCGGACTCGCGCGGATCGTCGCGACGCATGACGGCACGTCGATGCTCAAGGGCTACATGGAGTCGCT
GTCGAAGGTCCGCACCCGCTTCAACGTGATCAAGAACCAGGGCGACCCGGGGCCGGGCGCGCGCCAGCTG
ATGCAGCAGACGCTCGACGGCAACGGTTCGGAACTCGCCGATTCGCTGAAGCTCGTCGACGAGCAGATGT
TGACGGGCCTGACCGATTCGCAACGCAAGTCGCTGCGCCCGCTGCTGGTGCGGCCGCTGATGCAGGCGTT
CGCGGTCGTGATCCAGCCGGCCAGCGCCGAAGTCAACAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTC
CAGAGCTCGCTCGCGACCAAGTACCCGTTCGCGGCGAACGCGAAGGTCGAGGCCGGCGCCGGCGAGATCG
CGCAGGTGTTCGGTCCGGACGGCTCGATCGCGAAGTTCGTCGGCACGACGCTCGGGCCGCTCGCGGTGCG
CCGCGGCGACACGCTCGCCGCCCGCACGTGGGGCGACATGGGCATCGGGCTCACGCCGGACTTCACGAAC
GGCTTCGCACGCTGGGTCGCGCCGCTCGCGGGCGGCGCCGCCGGCAGCGCGGCCGCGTCGGCCGAACCGC
AGACCGTGTTCCAGATCCTGCCGCAACCGAGCACGGGCACGACGGAATACACGATCGCGATCGACGGCCA
GCAGCTGCGCTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCAAACCCGCAGGGCGCGCCG
GGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACG
GTCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGACGGCACCTTCGATCTGACGTGGGC
ACAAGGCAGCGTGAACGTGTCGGTGACGATGCGCATCATCAGCACGTCGCAACCGTCGGCCGGTGGCGGC
GACCAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCAGCTGCCGTCGTCGGTCGCCGACGCGAGCGCGGGCG
CCGCGCAGAACGCGACGCAAGCCGGCACCGGCACGCCGGGCGCCGCGCCGGCCGTCGCGGCCGCCAACGC
AACGAATGCACAGAGGGCGCAATGA
 Primer design