SecReT6
Protein ID: 107024166
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2622
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2885566..2886309 [+]
ProductOmpA/MotB protein
NoteTagL
UniProt IDQ1BS85, Q1BS85
KEGG IDbcn:Bcen_2622
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.20E-25, Aligned region: 80..114
OmpA [PF00691], Evalue: 1.20E-25, Aligned region: 145..239
BON [PF04972], Evalue: 3.50E-05, Aligned region: 18..56
BON [PF04972], Evalue: 3.50E-05, Aligned region: 91..111
Protein Sequence: 247 a.a.     [Download]
>gi|107024166|ref|YP_622493.1| OmpA/MotB protein [Burkholderia cenocepacia AU 1054]
MVHGTAGTIAPPPANATPGQVVVGGKVPDEATKAAVLQKLRDTYGATNVVDQVEVGDVATPPNWSANVQK
LLGAQLKQISKGQLKINGTQIEMKGEVHNEAQRQQLASDMANTLNPTYTIKNGLRVSASEQGVLDQTLAN
RTIEFETGSATLTPQGKLILDQMAAALAKMQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSI
PPQQMTTTGVGPDQPIAPNDMADGRARNRRIEFRVGQ
 
Nucleotide Sequence: 744 bp     [Download]
>gi|107021562|ref|NC_008060.1|:2885566-2886309 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
GTGGTGCACGGCACCGCCGGCACGATCGCGCCGCCGCCCGCGAACGCGACGCCCGGCCAGGTGGTGGTCG
GCGGCAAGGTGCCCGACGAGGCGACCAAGGCCGCCGTGCTGCAGAAGCTGCGCGACACCTACGGCGCGAC
GAACGTCGTCGACCAGGTCGAGGTGGGCGACGTCGCGACGCCGCCGAACTGGAGCGCGAACGTGCAGAAG
CTGCTCGGCGCGCAGCTCAAGCAGATCAGCAAGGGCCAGTTGAAGATCAACGGCACGCAGATCGAGATGA
AGGGCGAGGTGCACAACGAGGCGCAGCGCCAGCAGCTTGCGAGCGACATGGCGAACACGCTGAACCCGAC
GTACACGATCAAGAACGGGCTGCGCGTGTCGGCGTCCGAACAGGGCGTGCTCGACCAGACGCTCGCGAAC
CGGACGATCGAGTTCGAGACCGGCAGCGCGACGCTGACGCCGCAGGGCAAGCTGATCCTCGACCAGATGG
CGGCCGCGCTGGCGAAGATGCAGAACCGCACGGTCGACATCATCGGCCACACCGACAACTCGGGGAACCG
GACGTCGAACATCGCGCTGAGCCAGGCGCGCGCGGATGCGGTGAAGGGGTATCTGATCACGAAGAGCATT
CCACCGCAGCAGATGACGACAACGGGGGTGGGCCCGGATCAGCCTATTGCGCCGAATGATATGGCGGATG
GGCGGGCGAGGAATCGGCGGATCGAGTTCCGGGTGGGGCAGTAA
 Primer design