SecReT6
Protein ID: 107024169
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2625
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2888276..2888533 [+]
ProductOmpA/MotB protein
NoteTagL
UniProt IDQ1BS82, Q1BS82
KEGG IDbcn:Bcen_2625
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.00E-20, Aligned region: 2..77
Protein Sequence: 85 a.a.     [Download]
>gi|107024169|ref|YP_622496.1| OmpA/MotB protein [Burkholderia cenocepacia AU 1054]
MAAALAKMQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSIPPQQMTTTGVGPDQPIAPNDTA
DGRARNRRIEFRVGQ
 
Nucleotide Sequence: 258 bp     [Download]
>gi|107021562|ref|NC_008060.1|:2888276-2888533 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGGCCGCCGCGCTGGCGAAGATGCAGAACCGCACGGTCGACATCATCGGTCACACCGACAACTCGGGGA
ATCGCACGTCGAACATCGCGCTGAGCCAGGCGCGCGCGGATGCGGTGAAGGGTTATCTGATCACGAAGAG
CATTCCGCCGCAGCAGATGACGACGACGGGGGTCGGGCCGGATCAGCCGATTGCGCCGAACGATACGGCG
GATGGCAGGGCGAGGAATCGGCGGATCGAGTTCCGGGTGGGGCAGTGA
 Primer design