SecReT6
Protein ID: 107024174
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2630
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2893904..2896447 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ1BS77
KEGG IDbcn:Bcen_2630
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-67, Aligned region: 42..354
Phage_GPD [PF05954], Evalue: 1.80E-67, Aligned region: 633..664
T6SS_Vgr [PF13296], Evalue: 1.50E-36, Aligned region: 525..631
Phage_base_V [PF04717], Evalue: 1.80E-20, Aligned region: 425..515
Protein Sequence: 847 a.a.     [Download]
>gi|107024174|ref|YP_622501.1| Rhs element Vgr protein [Burkholderia cenocepacia AU 1054]
MNVTELAQAIRGGLIQQDRLLKTDIPSLPNNALVPRRAVTRSELGRDFSVTLDLVSTASDVELKTLVAQP
ITLWIQQADRSYQPINGYIHTARRLGADGGLSSYQLRFASWMHFLKFRSDMRYWQDQPVDAILADVFDRH
PQARGQYRFALSKPLPSRSYCRQSETDWNFVHRLMEDEGLFGFWRHSEDGKAHTFVITDDLHTVDALSPN
TVRFDRSGSGAETAGFTQWTASRTLQSTLHTTRTFDYKSPSSAGNPNGTSLPTKSGQGELPDQAEIYEYT
GAYTYPAQDRGEHLSKIRLEEWESRAKRFFGVGGVRSIDAGRRFTLVDHPEHDRDAASDREFAAIGVTRY
IENNLPASDHEASFPHSLQDALAQVKAGHGKGGAFEVGHDDGSAGFYLVEVEAQRASMPYRSPFEHRKPA
MQLETAVVVGPKGEEVYTDALNRIKVMFVWDRQSEGRETASCWMRVVQSDTGGGYGAVHIPRVGEEVLIG
YIGGDCDRPIVMHRVYNGAAKPQWHSDGLLSGFRSKEYAGSGHNEMVLDDATGQNRARLFSSSGNSLLHL
GYLIEQNGNTRGAYLGSGFDLRTDAYGALRAGQGLYVTTHPKQANSQPLDVTEAKQQLGSAEGLIESMSR
VSEMHQAESLGTGRDALKQFADATQNSVAGVASGGGRQDGRRRNGECQCVQGTRDAVREPGGDRDGVAAV
GASGERAAHQYCQRAKHVRDQWEIADRRHPGSHQPVRAERRDEAVCREGQGRGPGARGQRRTHRAKGRED
GSGDRGCRRGCEAGDIADVGWRVHPDQGRQNRASRTRESRFQGGAAPVQRTDEHAVSIARDAGRHVQAMR
AERAQRS
 
Nucleotide Sequence: 2544 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2896447-2893904 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGAACGTGACCGAACTGGCCCAGGCGATTCGTGGCGGCCTGATCCAGCAGGATCGGCTGCTGAAGACGG
ACATCCCGTCGTTGCCGAACAATGCGCTCGTGCCGCGTCGCGCCGTAACCCGCTCGGAGCTCGGCCGTGA
TTTCAGCGTAACGCTCGATCTGGTGTCCACCGCGAGCGACGTCGAGCTCAAGACGCTGGTCGCGCAGCCG
ATCACGCTGTGGATTCAGCAGGCGGACAGGTCGTATCAGCCGATCAACGGCTATATCCACACGGCGCGGC
GGCTCGGTGCCGACGGCGGCCTGTCGAGTTACCAGCTGCGCTTCGCGTCGTGGATGCACTTCCTCAAGTT
CCGTAGCGACATGCGGTACTGGCAGGACCAGCCGGTCGACGCGATCCTCGCCGACGTGTTCGACAGGCAT
CCGCAGGCCAGGGGCCAATACCGGTTCGCGCTGTCGAAGCCGCTGCCGTCCCGTTCGTACTGCCGCCAGA
GCGAAACCGACTGGAACTTCGTGCATCGGCTGATGGAGGACGAAGGGCTGTTCGGCTTCTGGCGGCACAG
TGAAGACGGGAAGGCGCATACGTTCGTCATCACTGACGATCTGCATACCGTCGATGCGCTGTCGCCGAAT
ACCGTCAGGTTCGATCGCTCGGGCAGCGGCGCCGAAACCGCCGGTTTCACGCAATGGACCGCGTCGCGGA
CCTTGCAAAGTACGCTGCATACGACGCGCACGTTCGACTACAAGTCGCCGTCGTCGGCGGGCAATCCGAA
CGGCACGTCGCTGCCGACGAAAAGCGGGCAGGGCGAGCTGCCCGATCAGGCGGAAATTTACGAATACACC
GGCGCTTACACGTATCCGGCGCAGGACCGCGGCGAACACCTGTCGAAGATTCGCCTCGAGGAATGGGAGT
CGCGTGCGAAGCGTTTCTTCGGCGTGGGCGGCGTGCGTTCGATCGACGCCGGCCGGCGTTTCACCCTCGT
CGACCATCCGGAGCACGATCGCGATGCGGCGAGCGACCGCGAGTTCGCGGCCATCGGCGTCACGCGTTAC
ATCGAGAACAATCTGCCGGCCTCTGACCACGAAGCAAGTTTCCCGCATAGCCTGCAGGACGCGCTGGCGC
AGGTGAAGGCCGGGCACGGGAAAGGGGGCGCGTTCGAGGTCGGGCACGACGACGGCTCGGCCGGGTTCTA
TCTCGTCGAGGTCGAGGCGCAGCGCGCGAGCATGCCGTACCGCAGCCCGTTCGAGCACCGCAAGCCCGCG
ATGCAGCTCGAGACGGCCGTCGTGGTCGGTCCGAAGGGCGAGGAGGTCTATACCGACGCGCTGAACCGGA
TCAAGGTCATGTTCGTGTGGGACCGGCAGAGCGAAGGCCGCGAGACGGCATCGTGCTGGATGCGCGTCGT
GCAATCGGATACCGGCGGCGGTTACGGCGCGGTGCATATTCCGCGCGTCGGCGAGGAAGTGCTGATCGGC
TACATCGGCGGCGACTGCGATCGGCCGATCGTCATGCATCGTGTCTACAACGGGGCGGCCAAGCCGCAAT
GGCATAGCGACGGGCTCCTGTCGGGCTTCCGGTCGAAGGAGTATGCGGGGTCGGGGCACAACGAGATGGT
GCTCGACGACGCGACTGGGCAGAACCGCGCGCGCCTGTTCAGCAGCAGCGGGAATTCGCTGCTTCATCTC
GGCTATCTGATCGAGCAGAACGGCAACACCCGTGGTGCGTATCTCGGCTCGGGTTTCGATCTGCGCACGG
ATGCGTACGGCGCGCTGCGCGCGGGCCAAGGGCTGTACGTGACGACGCATCCGAAGCAGGCGAACAGTCA
GCCGCTCGATGTGACGGAGGCGAAGCAGCAGCTTGGCAGTGCAGAAGGGTTGATCGAGTCGATGTCGCGG
GTGAGCGAGATGCATCAGGCCGAGAGCCTCGGTACCGGTCGCGATGCGCTGAAGCAGTTCGCCGATGCGA
CGCAGAACAGCGTGGCGGGGGTGGCCTCGGGGGGGGGGCGGCAGGACGGCCGGCGGCGGAACGGGGAATG
CCAATGCGTTCAAGGAACCCGTGATGCTGTTCGCGAGCCCGGCGGGGATCGGGATGGCGTCGCAGCAGTC
GGTGCATCTGGCGAGCGAGCAGCACACCAATATTGTCAGCGGGCAAAGCACGTTCGTGACCAGTGGGAAA
TCGCTGATCGCCGGCATCCGGGATCGCATCAGCCTGTTCGCGCAGAACGCCGGGATGAAGCTGTTTGCCG
GGAAGGGCAAGGTCGAGGTCCAGGCGCACGCGGACAACGTCGAACTCACCGCGCAAAAGGCCGTGAAGAT
GGTAGCGGCGACCGAGGCTGTCGACGTGGCTGCGAAGCAGGAGATATTGCTGACGTCGGGTGGCGCGTAC
ATCCGGATCAAGGGCGGCAAAATCGAGCTTCACGCACCCGGGAAAGTCGATTTCAAGGGGGCGCAGCACC
AGTTCAGCGGACCGACGAGCATGCAGTATCCATTGCCCGCGATGCCGGGCGGCACGTGCAAGCAATGCGT
GCTGAACGCGCACAGCGGTCGTGA
 Primer design

Protein ID: 107024192
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2648
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2916636..2919827 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ1BS59
KEGG IDbcn:Bcen_2648
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-73, Aligned region: 42..353
Phage_GPD [PF05954], Evalue: 5.40E-73, Aligned region: 603..650
DUF2345 [PF10106], Evalue: 4.40E-60, Aligned region: 668..820
DUF2345 [PF10106], Evalue: 4.40E-60, Aligned region: 939..1009
T6SS_Vgr [PF13296], Evalue: 3.40E-37, Aligned region: 524..630
Phage_base_V [PF04717], Evalue: 5.00E-20, Aligned region: 424..514
Phage_base_V [PF04717], Evalue: 5.00E-20, Aligned region: 875..894
Sarcoglycan_1 [PF04790], Evalue: 0.0041, Aligned region: 714..785
Protein Sequence: 1063 a.a.     [Download]
>gi|107024192|ref|YP_622519.1| Rhs element Vgr protein [Burkholderia cenocepacia AU 1054]
MNMQNTIAALRGGLLQQDRLLKLDTPLGSNVLTVQRAVGRSRIGRAYEFTLDVLSTDSDLELKKLIAQPV
TLWIQQGDRSYRPMNGYVHTARRLGADGGLTTYQLTFADFTHFLKFRRDQRIWNDTTVDQIISDVLNQHP
QAKGHFRFALSKPLPNRSYTRQHDTDWHFIHRLMEDEGLYCAWQQADDGKSHTLVVTDNLQAFAPLSPQT
VRFYRGGAASEADAFTQWSGTRTLQSVTRSTRTFDYKNPAQPSNPKGTSLPTMAGQGELPDQLEVYEYTG
AYTYLDQTRGDHLTKIRMEQWESEAKRFHGAGGVRAIDAGRRFTLADHPEHDRDPADQREFAAIGVEWWI
ENNLPVSNGSTDFPYSLREALTQAQEGYGADPAFRVPHDDGSVGFYLVEVEAQRVNVPYRSPFEHKKPEM
HLETAIVVGPQGEEVYTDELNRTRVQFVWDRLNPGNENASCWVRVVQSDTGGGYGGVHVPRIGEEVLIDY
VGGDCDRPLAVGRVYNGANQPQWHSDGILSGYRSKEYSGGGYNQLVMDDATGQNRVQLMSSSANSLLHLG
YIIDQNGNARGSYLGSGFDLRSDAYGAVRASQGLYVTTHPKAANSQPLDVKEAQQQLVAGESLVEAMSGV
SEQHQAESLKDAQDTMRAFTDATQDSQSGSAAGGRTAGGGTGNANAFKEPVMLFGSPSGIGMSTQQSVHM
VANDHVNVASGQSVHVAAGKSLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQSDNIEVTAQKAVRVVSA
TDRIEIAADQGILLTSGGGYIRIKDGDIEIHTPGAVDVKGASHTFAGPASMGYPLPSPRPDQPGQLELFH
KYVNGEAVKGGLFTVKDVNGAVLKKGALDNSGYTVVSGLPPGAVRVEFGKDPRESDQPANYFKQAKWPAE
PVQPSPEAAQAAASGQLASQLQGMAPAATTAAMGLVSGGGAGAALGGLASAALPAAATALGGAGVASALQ
TASSLSGAAKQVAGMVQAARQGGLAALAAPAANAASGALQGALPGALPGVAGIAGKGATTVASAAGATGM
KLPTSGFGGPLKS
 
Nucleotide Sequence: 3192 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2919827-2916636 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGAACATGCAGAACACAATCGCCGCATTGCGCGGCGGATTGCTTCAGCAGGACCGGTTGTTGAAGCTCG
ATACGCCATTGGGGAGCAACGTCCTGACCGTGCAGCGGGCAGTTGGCCGCTCACGTATCGGGCGCGCGTA
CGAATTCACGCTGGACGTACTGTCGACCGATAGCGATCTGGAGCTTAAAAAGCTGATCGCGCAGCCGGTC
ACGTTGTGGATTCAGCAAGGCGATCGCAGCTATCGGCCGATGAACGGCTACGTGCACACCGCGCGCCGTC
TGGGCGCCGACGGCGGGCTCACGACCTATCAGCTCACGTTCGCCGATTTCACCCATTTCCTGAAGTTCCG
TCGCGACCAGCGGATCTGGAACGATACGACCGTCGACCAGATCATCAGCGACGTGCTGAACCAGCATCCG
CAGGCGAAAGGCCATTTCCGCTTTGCGCTGTCGAAGCCGTTGCCGAACCGCTCGTACACGCGACAGCACG
ACACCGACTGGCATTTCATCCATCGACTGATGGAGGACGAAGGGCTCTACTGCGCGTGGCAGCAGGCCGA
CGACGGCAAGTCGCACACGCTCGTGGTGACCGACAACCTGCAGGCGTTCGCGCCGCTATCGCCGCAGACC
GTGCGCTTCTATCGTGGCGGGGCGGCGAGCGAAGCCGATGCGTTCACGCAATGGTCGGGCACGCGCACGC
TGCAGAGCGTCACGCGTTCGACGCGCACGTTCGACTACAAGAATCCCGCGCAGCCGTCGAATCCGAAAGG
CACGTCGCTGCCGACGATGGCCGGTCAGGGCGAATTGCCCGATCAGCTCGAAGTCTACGAATACACCGGT
GCGTACACGTATCTGGACCAGACGCGCGGCGACCATCTGACGAAGATCCGGATGGAGCAGTGGGAGTCGG
AGGCGAAGCGCTTCCACGGCGCGGGCGGCGTGCGTGCGATCGATGCCGGCCGGCGCTTCACGCTGGCGGA
TCATCCCGAACACGATCGCGATCCGGCCGACCAGCGCGAATTCGCGGCGATCGGCGTCGAATGGTGGATC
GAGAACAACCTCCCCGTTTCGAACGGCAGCACGGATTTTCCGTACAGCCTGCGTGAAGCGTTGACGCAAG
CGCAGGAGGGCTACGGTGCCGACCCCGCGTTTCGCGTGCCGCACGACGACGGCTCGGTCGGCTTCTATCT
CGTCGAGGTCGAAGCGCAGCGCGTGAACGTGCCGTATCGCAGCCCGTTCGAGCATAAAAAGCCGGAGATG
CACCTCGAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGGAGGTTTATACCGACGAGCTGAACCGGACTC
GCGTGCAGTTCGTGTGGGATCGCCTGAACCCGGGCAACGAGAACGCATCGTGCTGGGTGCGCGTCGTGCA
GTCGGATACGGGCGGCGGCTACGGCGGTGTGCACGTGCCGCGCATCGGCGAGGAAGTGCTGATCGACTAC
GTCGGCGGCGACTGCGACCGGCCGCTGGCCGTGGGGCGCGTGTACAACGGCGCGAACCAGCCGCAGTGGC
ATAGCGACGGGATTCTGTCCGGCTATCGATCGAAGGAGTATTCGGGCGGCGGCTACAACCAGCTCGTGAT
GGACGACGCGACCGGGCAGAACCGCGTGCAACTGATGAGCAGCAGCGCGAACAGCCTGCTGCATCTCGGC
TACATCATCGACCAGAACGGCAATGCGCGCGGGTCGTATCTGGGCAGCGGTTTCGATCTGCGCTCGGATG
CGTATGGCGCGGTGCGGGCGAGCCAGGGCCTGTACGTGACGACGCACCCGAAGGCGGCGAACAGCCAGCC
GCTCGACGTGAAGGAGGCGCAGCAGCAGCTCGTGGCGGGCGAGAGCCTGGTCGAGGCGATGTCGGGCGTG
AGCGAGCAGCATCAGGCGGAGAGCCTGAAGGACGCGCAGGACACGATGCGTGCATTCACGGACGCGACGC
AGGACAGCCAGTCGGGCAGCGCGGCGGGCGGGCGCACGGCGGGCGGCGGCACCGGTAACGCGAACGCGTT
CAAGGAACCGGTGATGCTGTTCGGCAGCCCGTCGGGAATCGGGATGTCGACGCAGCAGTCGGTGCATATG
GTCGCGAACGATCACGTGAACGTGGCAAGCGGGCAGAGCGTGCACGTGGCCGCGGGCAAGTCGCTGATCG
GCAGCATCGGGCAGAAGCTGAGCCTGTTCGTGCAGAACGCGGGGATGAAGCTGTTCGCGGGCAAGGGCAA
GGTCGAGATCCAGGCGCAGTCGGACAACATCGAGGTGACCGCGCAGAAGGCGGTGAGGGTGGTGTCGGCG
ACGGACCGGATCGAGATCGCGGCCGATCAGGGGATTTTGCTGACGAGCGGCGGCGGATATATCCGCATCA
AGGACGGCGACATCGAGATTCATACGCCGGGCGCGGTCGATGTGAAGGGGGCGTCGCATACGTTCGCGGG
GCCGGCGAGCATGGGGTATCCGCTGCCGAGCCCGCGGCCGGATCAGCCCGGGCAGCTCGAACTGTTTCAC
AAGTACGTGAACGGCGAGGCGGTGAAGGGCGGGCTGTTCACGGTGAAGGACGTGAACGGCGCCGTGCTGA
AGAAAGGCGCACTCGACAACAGCGGCTATACGGTCGTGAGCGGCTTGCCGCCGGGGGCGGTGCGCGTCGA
ATTCGGGAAAGACCCACGCGAGTCGGATCAGCCGGCGAACTATTTCAAGCAGGCGAAGTGGCCGGCGGAG
CCCGTGCAACCGTCGCCCGAGGCCGCGCAGGCCGCGGCGAGCGGACAGCTCGCGAGTCAGCTGCAAGGGA
TGGCGCCGGCCGCGACGACCGCGGCGATGGGGCTGGTGAGCGGCGGCGGCGCGGGTGCGGCCCTCGGCGG
GCTCGCGAGCGCCGCATTGCCGGCTGCTGCGACCGCGTTGGGTGGCGCCGGCGTGGCGTCCGCGTTGCAG
ACCGCCTCGAGCCTGAGCGGTGCGGCGAAGCAGGTGGCCGGGATGGTTCAGGCCGCCCGTCAGGGCGGGC
TTGCCGCGCTTGCCGCGCCGGCTGCGAATGCGGCGTCCGGGGCGTTGCAGGGCGCGTTGCCCGGTGCATT
GCCGGGCGTGGCCGGTATCGCGGGCAAGGGCGCCACGACCGTGGCGTCGGCCGCGGGCGCGACGGGCATG
AAACTGCCGACAAGCGGGTTTGGCGGACCGTTGAAATCCTGA
 Primer design