SecReT6
Protein ID: 107024175
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2631
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2896514..2897635 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDQ1BS76
KEGG IDbcn:Bcen_2631
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.60E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|107024175|ref|YP_622502.1| ImpA domain-containing protein [Burkholderia cenocepacia AU 1054]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDFWDTFHPLPEDDDIEHRLGNVAWLSGRTAELLRA
VPLTDGASNAFSTLDWEVAQHVAQSIKRDPEHADDIARGKPSIDQIDASRRVTSIAFYTALLANLKAFEF
ALDAFEERLVERAGDSAPSFRQARDAFETVYRLAERFAREQGYTGSAPHAQAAPQAQPERVEPVFGQPIQ
TEETHVQQQTASRPPVTQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQA
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2897635-2896514 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGCCGATCAATCTCCCCGAGCTGCTGACACCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TTTCGAACGAATTCGACGCGATCCAGGACGCGCGGCGCTACGACGACCCGACGCTCGACCAGGGCGAATG
GGTAACCGAGATCAAGGAGGCCGACTGGGGCTTCGTCGTCGACCATGCGGGCGAGCTGCTGCGCACCCGC
ACCAAGGACCTGCGGCTCGCCGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCACCGGCCTCA
CCGAAGGCTATGCGCTGCTCGAAGGCCTGTGCCGCGACTTCTGGGACACCTTTCACCCGCTGCCCGAGGA
CGACGACATCGAGCACCGGCTCGGCAACGTCGCGTGGCTGTCCGGCCGCACGGCCGAGCTGCTGCGCGCG
GTGCCGCTGACGGACGGCGCATCGAATGCGTTCAGCACGCTCGATTGGGAAGTCGCGCAGCACGTCGCGC
AGTCGATCAAGCGCGACCCCGAACATGCCGACGACATCGCGCGCGGCAAGCCGTCGATCGACCAGATCGA
CGCGTCGCGGCGCGTGACGTCGATCGCGTTCTACACGGCGCTGCTGGCGAACTTGAAGGCGTTCGAATTC
GCGCTCGATGCGTTCGAGGAGCGGCTCGTCGAGCGCGCGGGCGATTCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTTCGAGACCGTGTACCGGCTCGCCGAGCGCTTTGCGCGCGAACAGGGCTATACGGGCAGCGC
GCCGCACGCGCAGGCGGCGCCGCAGGCCCAGCCCGAACGCGTCGAGCCGGTGTTCGGCCAGCCGATCCAG
ACCGAGGAGACTCACGTGCAGCAGCAGACCGCTTCGCGTCCGCCGGTGACGCAGATGATCGCCGGCATCC
AGAACCGCGCGCAGGCCGTCGACCAGTTGCGCGCGGTGGCGCGCTATTTCCGTCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTTGCCGACAAGGCGGCCGAGTGGGCCGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTGAAGGACGACGGCTCGCTGTCGCACATTCGCGAGCTGCTGGGGGTGAGGCCCGACGAGCAGGCGT
GA
 Primer design