SecReT6
Protein ID: 107024176
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2632
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2897679..2899724 [-]
ProductATPase AAA
NoteTssH
UniProt IDQ1BS75
KEGG IDbcn:Bcen_2632
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-44, Aligned region: 23..121
AAA_2 [PF07724], Evalue: 1.20E-44, Aligned region: 411..579
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 24..137
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 269..305
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 416..533
AAA_5 [PF07728], Evalue: 7.50E-14, Aligned region: 24..44
AAA_5 [PF07728], Evalue: 7.50E-14, Aligned region: 98..154
AAA_5 [PF07728], Evalue: 7.50E-14, Aligned region: 415..535
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 2..48
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 68..102
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 266..331
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 388..451
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 481..504
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 581..621
ClpB_D2-small [PF10431], Evalue: 4.90E-12, Aligned region: 586..659
AAA_22 [PF13401], Evalue: 5.10E-07, Aligned region: 24..110
AAA_22 [PF13401], Evalue: 5.10E-07, Aligned region: 412..435
AAA_22 [PF13401], Evalue: 5.10E-07, Aligned region: 477..509
Sigma54_activat [PF00158], Evalue: 9.00E-07, Aligned region: 4..40
Sigma54_activat [PF00158], Evalue: 9.00E-07, Aligned region: 392..532
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 25..94
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 415..451
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 599..606
IstB_IS21 [PF01695], Evalue: 7.40E-05, Aligned region: 9..45
IstB_IS21 [PF01695], Evalue: 7.40E-05, Aligned region: 415..433
IstB_IS21 [PF01695], Evalue: 7.40E-05, Aligned region: 589..626
Arch_ATPase [PF01637], Evalue: 7.90E-05, Aligned region: 2..38
Arch_ATPase [PF01637], Evalue: 7.90E-05, Aligned region: 76..158
Arch_ATPase [PF01637], Evalue: 7.90E-05, Aligned region: 413..452
Arch_ATPase [PF01637], Evalue: 7.90E-05, Aligned region: 486..510
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 22..50
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 411..437
AAA_29 [PF13555], Evalue: 0.00032, Aligned region: 16..40
AAA_29 [PF13555], Evalue: 0.00032, Aligned region: 411..440
AAA_29 [PF13555], Evalue: 0.00032, Aligned region: 506..535
AAA_14 [PF13173], Evalue: 0.00048, Aligned region: 25..158
AAA_14 [PF13173], Evalue: 0.00048, Aligned region: 277..320
AAA_14 [PF13173], Evalue: 0.00048, Aligned region: 414..496
SRP54 [PF00448], Evalue: 0.00068, Aligned region: 24..45
SRP54 [PF00448], Evalue: 0.00068, Aligned region: 414..447
NACHT [PF05729], Evalue: 0.00073, Aligned region: 24..51
NACHT [PF05729], Evalue: 0.00073, Aligned region: 173..253
NACHT [PF05729], Evalue: 0.00073, Aligned region: 416..437
Zeta_toxin [PF06414], Evalue: 0.00086, Aligned region: 23..44
Zeta_toxin [PF06414], Evalue: 0.00086, Aligned region: 405..455
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 24..47
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 80..119
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 235..283
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 410..433
AAA_30 [PF13604], Evalue: 0.0012, Aligned region: 9..101
AAA_30 [PF13604], Evalue: 0.0012, Aligned region: 410..439
MobB [PF03205], Evalue: 0.0014, Aligned region: 25..48
MobB [PF03205], Evalue: 0.0014, Aligned region: 414..448
AAA_18 [PF13238], Evalue: 0.0021, Aligned region: 26..44
AAA_18 [PF13238], Evalue: 0.0021, Aligned region: 264..329
AAA_18 [PF13238], Evalue: 0.0021, Aligned region: 417..445
ResIII [PF04851], Evalue: 0.0025, Aligned region: 12..44
ResIII [PF04851], Evalue: 0.0025, Aligned region: 88..106
ResIII [PF04851], Evalue: 0.0025, Aligned region: 279..305
ResIII [PF04851], Evalue: 0.0025, Aligned region: 387..436
RNA_helicase [PF00910], Evalue: 0.0035, Aligned region: 25..45
RNA_helicase [PF00910], Evalue: 0.0035, Aligned region: 416..437
DEAD [PF00270], Evalue: 0.0038, Aligned region: 10..180
DEAD [PF00270], Evalue: 0.0038, Aligned region: 363..403
DEAD [PF00270], Evalue: 0.0038, Aligned region: 415..442
Mg_chelatase [PF01078], Evalue: 0.0073, Aligned region: 20..40
Mg_chelatase [PF01078], Evalue: 0.0073, Aligned region: 415..461
Hpr_kinase_C [PF07475], Evalue: 0.0086, Aligned region: 24..37
Hpr_kinase_C [PF07475], Evalue: 0.0086, Aligned region: 54..78
Hpr_kinase_C [PF07475], Evalue: 0.0086, Aligned region: 416..432
Protein Sequence: 681 a.a.     [Download]
>gi|107024176|ref|YP_622503.1| ATPase AAA [Burkholderia cenocepacia AU 1054]
MIGREAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGA
SVKGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEY
KKYFEKDAALARRFQVVKVEEPSEPLAAAMLRGMSGLMEKHFNVRILDDAITEAVRLSHRYISGRQLPDK
AISVLDTACAKVALAHSATPAAIDDTKKRIERIDAEIASLEREAAGGAAHDERLGELRGARDTALEQLAK
DEERYEAERVIVAEITELRDALDRARGPSEDGQPVDVQATREKLAERVAALHALQGGEPMVPLQVDGHVV
AEIVAAWTGIPLGRMVKDEIDTVLNLQPLLTARVIGQDHALEAIAQRVRTATANLEDPNKPRGVFMFVGP
SGVGKTETALALADILYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLL
DEVEKAHPDVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSAAVMQACLNKPAEELPDPDALAEA
LRPQLYKTFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEV
DSGARNVDHILNGTLLPEIAGHVLGRIADGAAIARIAVRADEAGEFAYTVE
 
Nucleotide Sequence: 2046 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2899724-2897679 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
GTGATCGGCCGCGAAGCGGAGATCCGCCAGGCGATCGACATCCTGATGCGCCGCCGCCAGAACAACCCGA
TCATGACCGGCGAGGCCGGCGTCGGCAAAACGGCGGTCGTCGAAGGGCTCGCGCTGCGGATCGCGGCCGA
CGACGTGCCGCCGCCGCTGCGCGGCGTCGCGCTGCACGTGCTCGACATGGGGCTGCTGCAGGCCGGCGCG
AGCGTGAAGGGCGAGTTCGAGAACCGGCTGAAGAGCGTGATCGACGAGGTGAAGAAGAGCGCGCACCCGA
TCATCCTGTTCATCGACGAGGCGCACACGATCATCGGCGCGGGCGGCCAGGCCGGCCAGAACGATGCGGC
GAACCTGCTGAAGCCCGCACTCGCGCGCGGCGAGCTGCGCACGATCGCCGCGACGACGTGGAGCGAATAC
AAGAAGTACTTCGAGAAGGATGCGGCGCTCGCGCGGCGTTTCCAGGTCGTGAAGGTCGAGGAGCCGAGCG
AGCCGCTGGCCGCCGCGATGCTGCGCGGGATGTCGGGCCTGATGGAGAAGCACTTCAACGTGCGGATTCT
CGACGATGCGATCACGGAGGCCGTGCGCCTGTCGCACCGCTACATCAGCGGCCGCCAGCTGCCGGACAAG
GCGATCAGCGTGCTCGATACCGCCTGCGCGAAGGTCGCGCTCGCGCACAGCGCGACGCCGGCCGCGATCG
ACGATACGAAGAAGCGCATCGAGCGCATCGATGCGGAAATCGCGTCGCTGGAGCGCGAGGCGGCGGGCGG
CGCGGCGCACGACGAGCGGCTCGGCGAGCTGCGCGGCGCGCGCGACACGGCGCTCGAACAACTGGCGAAG
GATGAGGAACGCTACGAAGCCGAGCGCGTGATCGTCGCCGAGATCACCGAGCTGCGCGATGCGCTCGACC
GCGCACGCGGCCCGTCGGAGGACGGCCAGCCGGTCGACGTGCAGGCCACTCGCGAGAAACTCGCCGAACG
CGTCGCGGCGCTGCACGCGCTGCAGGGCGGCGAGCCGATGGTGCCGCTGCAGGTCGACGGCCACGTCGTC
GCCGAGATCGTCGCCGCGTGGACGGGCATTCCGCTCGGCCGGATGGTGAAGGACGAGATCGACACCGTGC
TGAACCTGCAGCCGCTGCTGACCGCACGCGTGATCGGCCAGGATCATGCGCTGGAGGCGATCGCCCAGCG
TGTGCGCACCGCGACCGCGAACCTCGAGGACCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCG
TCGGGCGTCGGCAAGACCGAGACGGCGCTGGCGCTGGCCGACATCCTGTACGGCGGCGAGCGCAAGATGG
TCACGATCAACATGAGCGAGTACCAGGAAGCGCACAGCGTGTCGGGCCTGAAGGGGTCGCCGCCGGGCTA
CGTCGGTTACGGCGAAGGCGGCGTGCTGACCGAGGCCGTGCGTCGCAACCCGTATTCCGTCGTGCTGCTC
GACGAGGTCGAGAAGGCGCACCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCACGATGG
ACGATGCGGAAGGGCGCGAGATCGACTTCCGCAACACGCTGATCATCCTGACGTCGAACGTCGGCTCGGC
CGCGGTAATGCAGGCCTGCCTGAACAAGCCGGCCGAGGAGCTGCCCGATCCGGACGCGCTTGCCGAGGCG
CTGCGCCCGCAGCTGTACAAGACCTTCAAGCCGGCGTTCCTCGGCCGGATGAAGGTCGTGCCGTACTACC
CGATTTCCGACGACGTGCTGGCCGAGATCATCGAGCTGAAGCTCGAACGCATCCGCCGCCGGATCGAGGC
GAACCACAAGGCCGCGTTCGAGTGGGACGAGTCGCTCGTCGACGCGGTGCTCGCACGCTGCACCGAGGTC
GACTCGGGCGCCCGCAACGTCGACCACATCCTGAACGGCACGCTGCTGCCGGAGATCGCGGGCCACGTGC
TCGGCCGGATCGCCGACGGCGCGGCGATCGCGCGCATCGCGGTGCGCGCGGACGAGGCCGGCGAATTCGC
GTACACCGTCGAATGA
 Primer design