SecReT6
Protein ID: 107024178
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2634
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2900388..2901404 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ1BS73
KEGG IDbcn:Bcen_2634
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-88, Aligned region: 8..319
Protein Sequence: 338 a.a.     [Download]
>gi|107024178|ref|YP_622505.1| hypothetical protein Bcen_2634 [Burkholderia cenocepacia AU 1054]
MRVLEGLFARQASDAPGAWRQGDVVAQHIAFRNTLSLGFPPSEIEGARSFDDDGAPLNSDDERGTALAAG
ELGRVELTPAFFGLLGGQGALPLHYTEQIVAREHLRRDHAARAFFDVFSNRATALFYAAWKKYRLPFHYE
LDRDERYLPLLLAIAGVPSDEVRDSLAAGPGGVLDEAVAGYALAARHRPMSAAYLQRTLSDYFRVPVKID
QFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRARIVVGPLSKRDYEAFLPGGAHAVALERML
TLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRDALEDRSDARYELHVIH
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2901404-2900388 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
GTGCGGGTGCTCGAAGGGCTGTTCGCGCGGCAGGCGTCGGATGCGCCCGGCGCGTGGCGGCAGGGCGACG
TGGTCGCGCAGCACATCGCATTCCGCAACACGCTGTCGCTCGGCTTCCCGCCGAGCGAGATCGAAGGCGC
GCGTTCGTTCGACGACGACGGCGCGCCGCTGAACTCGGACGACGAGCGCGGCACCGCGCTGGCCGCCGGT
GAGCTCGGCCGCGTCGAGCTGACGCCCGCGTTCTTCGGGCTGCTCGGCGGGCAGGGCGCGCTGCCGCTGC
ACTACACCGAGCAGATCGTCGCGCGCGAGCACCTGCGGCGCGACCATGCGGCGCGTGCGTTCTTCGACGT
GTTCTCGAACCGCGCGACCGCGCTGTTCTATGCGGCGTGGAAGAAATACCGGCTGCCGTTCCATTACGAG
CTCGACCGCGACGAGCGCTACCTGCCGCTGTTGCTCGCGATCGCGGGCGTGCCGAGCGACGAGGTGCGCG
ACAGCCTCGCGGCCGGCCCGGGCGGCGTGCTCGACGAAGCCGTGGCCGGCTACGCGCTCGCGGCGCGGCA
CCGGCCGATGTCGGCCGCCTACCTGCAACGCACGCTGTCTGATTACTTCCGCGTGCCGGTGAAGATCGAC
CAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAGCTGAGCGTGCTCGGCGAAGTCAACGCGGTGC
TCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGGATCGTCGTCGGCCC
GCTGTCCAAGCGCGACTACGAGGCGTTCCTGCCCGGCGGCGCGCACGCCGTCGCGCTCGAGCGGATGCTG
ACGCTGCTCGCCGGCGTCACGCTCGAGTACGAGGTGAAGCTCGTGCTCAAGCGCACCGAGGTCGGCGCGA
GCGTGCTCGGCGCGGGCTCGCGGCTCGGCTGGGATGCGTTCCTGTGCACGCGCGATGCGCTGGAGGATCG
CTCGGACGCCCGCTACGAACTGCACGTGATTCACTGA
 Primer design