SecReT6
Protein ID: 107024179
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2635
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2901452..2903287 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ1BS72
KEGG IDbcn:Bcen_2635
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.20E-216, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|107024179|ref|YP_622506.1| hypothetical protein Bcen_2635 [Burkholderia cenocepacia AU 1054]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLSTLRAHLHGEQSFVAALTDCLFVNVLGA
YVEPERNGRWTALRKLPIAQAGFAEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRC
QRATLHLVLQDVRSDSHIARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPSMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2903287-2901452 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAACGCGAATTATCGTTTTTGCGGCGCTATTCGCGAGATTTCGCCG
AACGCTATCCGAAGATCGCCGCGCGTCTCGCGCTGTCCGGCGAGCATTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTCGGCGCGCGTATCAACAAGAAGCTCGACGACGATTACCCGGAATTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAGT
TCACGCCGGCGTCGCCCGGTCAGCAGACCGAACCGGTCGTGATCGATCGCGGCACCGAGCTGAAAAGCCG
CCCGATCCGCGGCGTGCAATGCCGGTTCCGTACCGCCTACGACGTGACGCTTGCGCCGATCCGCATCTCG
GAGGCGCGCTATACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCGAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGATCTCGGCGCGCTGAAGCTGTCGACGCTGCGCGC
GCACCTGCACGGCGAGCAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCAACGTGCTCGGCGCG
TACGTCGAGCCCGAACGCAACGGCCGCTGGACCGCGCTGCGCAAGCTGCCGATCGCGCAGGCCGGTTTCG
CCGAGGACGACGCGCTGATCGACTATCCGGCGAAATCGCATCCCGCGTACCGGCTGCTCACCGAATACTT
CGCGTTCCCCGACAAGTTCGATTTCGTCGACTTCGACCTCGCGGCGATCGCACGCGCGTCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTGGTGCTGCAGGACGTGCGCAGCGATTCGCATATCGCGCGCCTGCTCGAGC
TGCTGACGGCGAGCCATTTCCGGCTGTTCTGCACGCCGATCGTCAACCTGTTCCGCCAGCACGGGGAGCC
GATCCGCATCACGCACCGCGCGGTGTCGTATCCGGTGATTGCCGAGGCGCGGCGTGCGTTCGCGTACGAG
GTGTACTCGATCGACTCGGTGAAGCTCGTCCGGCAGCAGGCGCACGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCGCTGCATCACGGCGAATCGGCGCGCATCGGCCATTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAGAAGAGCCCCGGCTATGAAACCGAGATCTCGATCGTCGACATCGACTTCGAGCCGACGTCG
CCGCAGACCGACACGCTGAGCCTCGACCTCACCTGCACGAACCGCGACCTGCCTTCGATGCTGGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGAAGGCGGGGCGCAGACGAGCGGCATCTCGCTGCTGCGCCGCCC
GACGCAGAGCGTGCGCTTCGAGCGCGGCCGTGCCGCGCACTGGCGGCTCGTGTCGCATCTCGCGCTCAAC
CACGTGTCGCTCGTTGCGCACGGCCTCGCGCCGCTGAAGGAAATGCTGACGCTGTACGACCTGCGGCGCA
CGGCCGTGTCGATGCGCCAGATCGACGGGCTGGCCGGCGTCGAGCAGCGCGGGGCGGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCGACGAAGAGCACTTCGTC
GGCGCGAGCCTTGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTACGTCCACCTCAACAGTT
TCGTTCAATTGGTCGTCGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGAACCGGCGA
ATCGATCCTGGCGTAG
 Primer design