SecReT6
Protein ID: 107024180
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2636
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2903364..2903849 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ1BS71
KEGG IDbcn:Bcen_2636
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|107024180|ref|YP_622507.1| hypothetical protein Bcen_2636 [Burkholderia cenocepacia AU 1054]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTENELAALPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQATNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARAARMQ
 
Nucleotide Sequence: 486 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2903849-2903364 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGAAACGATTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCATCTGCCGGCCTCGGCTG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTCGCCCGCGACGTCGAGGCGATCCTCAACAC
CCGTATCGCGCACACCGAGAACGAGCTGGCGGCGCTGCCGGAATGCCAGAAGTCGGTGCTGACCTACGGG
CTGAACGATTTCGCGGGGCTGAGCCTCGCGAGCCATTACGACCGCGCATTCATCTGCAAGTCGATCCAGC
AGGCCATCGCGCGCCACGAGCCGCGCCTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGGCCAC
CAACGCGCTGTACTTCGCGATCCAGGCGCTGCTCGTCGTGCACCCGGCCGAGGAGCCGGTGAGTTTCGAC
GCGATGCTGCAACCGTCGACGCTGCAGTATTCGGTCACGCGCGCACGCGCGGCACGCATGCAGTAA
 Primer design