SecReT6
Protein ID: 107024181
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2637
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2903912..2904415 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ1BS70
KEGG IDbcn:Bcen_2637
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-43, Aligned region: 7..139
Protein Sequence: 167 a.a.     [Download]
>gi|107024181|ref|YP_622508.1| hypothetical protein Bcen_2637 [Burkholderia cenocepacia AU 1054]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2904415-2903912 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAGTCCGCGGATAAAGACCACCAAG
GCTGGATCGAACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCATCGACCGCTGG
CGGTCACACGATGACGCGTTGCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCATGCTTCGGGCGGTACCACGTTCGACGAAGTGACGGTCCATTTCTCGCGCGCGGACG
GTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTTCGCGAGGAAGGTCTGCCGCTCGAGACGTTCTCGCTGAAGTACGCAGCCGTGCAGTGGAAGCAAACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAAGGCGCCTGGAGTCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA
 Primer design