SecReT6
Protein ID: 107024183
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2639
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2905992..2906507 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ1BS68
KEGG IDbcn:Bcen_2639
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.60E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|107024183|ref|YP_622510.1| hypothetical protein Bcen_2639 [Burkholderia cenocepacia AU 1054]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|107021562|ref|NC_008060.1|:c2906507-2905992 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAGCTGACCTACG
AGGTCGAGAAGGGCGATGCGATCGAGGTGAAGGAGCTGCCGTTCGTCGTCGGGGTCGTTGGCGATCTGGC
GGGCCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGATCGTAAATTCGTCAACATCGACCGCGATAATTTC
GACGACGTGATGAAGGCGATCGAGCCGCGTGCCGCGTTCCAGGTGGAAAATCGCCTGAGCCCGGAAGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAACAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCCGAGGTGCTGAAGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CCGGCGGCGACAAAGACGGCGAATGA
 Primer design