SecReT6
Protein ID: 107024185
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2641
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2907562..2908173 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ1BS66
KEGG IDbcn:Bcen_2641
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 15..175
Protein Sequence: 203 a.a.     [Download]
>gi|107024185|ref|YP_622512.1| hypothetical protein Bcen_2641 [Burkholderia cenocepacia AU 1054]
MRSSMIRYALPLVACALLAGCAAAPLLGSAASAVMSAAGIGKPEVPDAQKPPRNIGLTLAAAPNLNAATD
HKPLALVVRLYALKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGI
VALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDGTVIAPQQGAPSQPLNLLSSVSCG
 
Nucleotide Sequence: 612 bp     [Download]
>gi|107021562|ref|NC_008060.1|:2907562-2908173 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGAGATCGTCCATGATTCGCTACGCGCTGCCGCTGGTTGCCTGCGCCCTTTTGGCCGGATGCGCGGCCG
CCCCGCTGCTCGGCTCGGCCGCGAGCGCCGTGATGTCCGCGGCCGGCATCGGCAAGCCCGAGGTGCCCGA
CGCGCAGAAGCCGCCGCGCAACATCGGGCTCACGCTGGCCGCCGCGCCGAACCTGAATGCCGCGACCGAC
CACAAGCCGCTCGCGCTCGTCGTCCGGCTTTATGCGCTGAAGGACCCGACCTCGTTCCAGCAAGCGCCGT
TCGACGCCTTTACCGATCCGACCAAGGAAAAAGCTGCACTCGGCGCCGATCTGCTGAATGTGCGCGAAAT
CACGCTGATTCCGGGCCAGCGCTATACGGCAACCGAGAAGGTATCGCGCGAGGCCCAGGCATTCGGCATC
GTCGCGCTGTTCCGCGATCCCGCACTGCAACGATGGAAACTGACATTCGATCCGGCGAAATCGGAGAAAT
CCGGCATAATCATCGGCCTGCATAATTGCGCGATGACGGTCACCGACGGCACGGTCATCGCACCGCAACA
AGGTGCGCCTTCGCAACCGCTGAATTTGCTGTCTTCGGTCTCTTGCGGTTAA
 Primer design