SecReT6
Protein ID: 107024186
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2642
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2908276..2909622 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ1BS65
KEGG IDbcn:Bcen_2642
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|107024186|ref|YP_622513.1| hypothetical protein Bcen_2642 [Burkholderia cenocepacia AU 1054]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRSPLYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|107021562|ref|NC_008060.1|:2908276-2909622 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAGCGACAGG
ACGCGTACCACGAGGCGCGCCTGTTCGAGTCCATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTC
GGTGCGCATCGACCGCGACGCGCTCGGCAGCAACGTGCTGCGGGTCGCCGAGCTCGCGCTCGTGTTCCCG
GACGGCGCGCTGTATGCCGCGCCGCAGGCAGACGATCTGCCGCCGCCGATCGCGCTGGATACGTTGCCCG
ACGGCATCAACGAATTCGTGTTCTATCTCGCGCTGCACCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCCGCCGGCTTCATGACGCGGTTCGTCAGCGAGCAGACGAGCGTTGCCGACAACTTCACCGAC
GCCGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTGTCGGTGCCGCTCGTGCGTGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAAGCGTCGCCGATCCTGCACCAGCGGCTGCGCCAGCTGGTCGACGCA
CTGCAGGCCAAGGTGAACGCGCTGTACGGCTTCCACCGCGAACCGTCCAAGAACATCATCGAATTCCGTT
CGGGCGACATCGCGTCGTTCTGGCTGCTGCATACGGCGAACGCCGCATTCGCGACGCTCGCGCACCTGCA
CCAGCACGCGGCGCTGCATCCGGAGCGGCTGTTCCAGGAACTGCTGCGCCTCGCGGGCCAGCTGATGACG
TTCTCGAAGGGCTATACGCTCGCCGACCTGCCCGTGTACCGTCACGACGACCCGGGCCCGAGCTTCGCGC
GCCTCGACCTGATGCTGCGCGAACTGCTCGACACCGTGATCTCGACGCGCTATTTCGCGATCACGCTCGA
CGAGGTGCGCCCGTCGTTCCACCTTGGCCGCCTCGATTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTCGCGGTATCCGCGGACATGCCGAGCGTCGAGCTCGTCGATGCGGTGCCGGCCCGCTTCAAGGTCGGCG
CGCCTGACGACGTCGACAAGCTCGTGCTGTCGGCGATGCCCGGCGTGCGGCTGTCGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGCCCCGGCGCGTGCTACTTCGCGCTCGATTCACGCAGCCCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA
 Primer design