SecReT6
Protein ID: 107024187
SecReT6 ID126
T6SS typei4b
Gene symbol-
Locus tagBcen_2643
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome I [GenBank: NC_008060] [Browse all T6SS(s) in this replicon]
Location [Strand]2909619..2910401 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ1BS64
KEGG IDbcn:Bcen_2643
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-58, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|107024187|ref|YP_622514.1| hypothetical protein Bcen_2643 [Burkholderia cenocepacia AU 1054]
MSYAPSLFGDNVPPPLHSPASTDSAFQARSLLDLLYDGFFMLFLLKNKREPDSASEFSTRIQEFLSDFER
GAKKLNIAAEDVYGAKFAFCAAIDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAAFAPHWPLPDQIAHRLKREVPVW
AIGTVFALVALLGYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|107021562|ref|NC_008060.1|:2909619-2910401 Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGTGCCGCCGCCCCTGCATAGCCCGGCATCGACGGACT
CCGCGTTCCAGGCCCGCTCGCTGCTCGATCTGCTGTACGACGGGTTCTTCATGCTGTTTCTGCTCAAGAA
CAAGCGGGAGCCGGACAGCGCCAGCGAGTTCAGCACGCGGATCCAGGAGTTCCTGTCGGATTTCGAGCGC
GGCGCGAAGAAGCTGAATATCGCCGCCGAGGACGTGTACGGCGCGAAGTTCGCGTTCTGCGCGGCCATCG
ACGAAATGGTGCTGTCGTCGCAGTTCAAGATCCGCGCGGATTGGGAACGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAGCTCGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGAGTGTCGTGCGCAGGGTGCGGCG
CGGCTGCAGTCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGGTTCCAGGGCAAGTATCTGCTCGAAG
GGCCGGAGAAGCTCGCGTATCTCACCGCGCGGCTTGGGGACGAGATCGCGCATATGAAGGGCAAGCGGGC
TGCGTTTGCGCCGCATTGGCCGCTGCCGGATCAGATCGCGCACCGGTTGAAGCGGGAGGTGCCGGTTTGG
GCGATCGGGACCGTGTTCGCGCTCGTTGCGTTGCTTGGGTATCTCGGGCTCAATACCTATCTCAAGGACA
AGACGCTGCAGGCGTTGGCGCCGTATTCGCAAGTCATCAAAGTGGGCCCGGAGTCGGCTAATTTGACGAT
TTCGTTGCCGTAA
 Primer design