SecReT6
Protein ID: 108757915
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4811
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6019075..6020826 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ1D301
KEGG IDmxa:MXAN_4811
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-183, Aligned region: 2..583
Protein Sequence: 583 a.a.     [Download]
>gi|108757915|ref|YP_632972.1| hypothetical protein MXAN_4811 [Myxococcus xanthus DK 1622]
MFSKYYLSELSYLREMGRAFGLANPSVAGLLVERGADPDVERLLEGFAFLAARIRERVDDDVPELVHGLT
ELLLPHYLRPLPASTIVEFTPHLRALRGRSRLAAGAEVASQPIDGTSCVFRTTTDVDLLPVQLTDALLDR
SSITAPVLRLYFQTTEQGRAEVLREQGLRLFIHADLSAASVVLLWLLRYCRQVRVRGASGQGDGIKLPVN
AIQPVGFHRDFKLLPWPRASEGYRHLQEYLTLPEKFLFFEVRGLDAAAGLKEDRFEIAFHLERPPPLDAR
IHREMFRLHCAPVVNLFSVPADPILHRTLDREHLLRASDLPPNHAEIYSVDSVTGLKAGRNERRVYRPFY
EFTHTAGGDAEQSFYRLRRAPSPLDEGIDTYITLETPRNIAPEVNAEEALSMDLTCTNRSLPSRLQVGDL
TASTSASPTQAKFKNISPVSRPARAPLGTELHWRLLSHLAINQHSLADAAALRRLMDLYNFHSLTDNLAA
RASRLRINAIRAVETKPVTRFLEGAPLRGHRTRVDLDEENFMGVGDSFLFGSVLEELLASHVTINSFNEL
SIRLHPSQTEFAWLPRNGSQTLL
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6019075-6020826 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGTTCAGCAAGTATTACCTGAGCGAGCTGTCGTACCTGCGGGAGATGGGACGGGCCTTCGGGCTGGCCA
ACCCCTCTGTCGCGGGCCTGTTGGTGGAGCGCGGCGCGGACCCGGACGTGGAGCGGCTGCTGGAGGGCTT
CGCGTTCCTCGCGGCCCGCATCCGCGAGCGCGTGGACGACGACGTGCCGGAGCTGGTGCACGGGCTCACC
GAGCTGCTGCTACCGCACTACCTGCGCCCGCTGCCGGCCTCCACCATCGTCGAGTTCACCCCGCACCTGC
GCGCGCTGCGCGGCCGCTCGCGGCTGGCCGCCGGGGCGGAGGTGGCGTCGCAGCCGATTGACGGCACCAG
TTGCGTCTTCCGCACCACCACGGACGTGGACCTGCTGCCGGTGCAGCTCACCGACGCACTCCTGGACCGG
TCGTCCATCACCGCGCCGGTGCTGCGCCTCTATTTCCAGACGACGGAGCAGGGCCGCGCGGAGGTGTTGC
GCGAGCAAGGCCTGCGCCTGTTCATCCACGCCGACCTGTCCGCTGCGTCGGTGGTGCTGCTGTGGTTGCT
CCGCTACTGCCGCCAGGTGCGCGTGCGCGGCGCGTCTGGCCAGGGAGACGGCATCAAGCTGCCGGTGAAT
GCCATCCAACCGGTGGGCTTCCACCGGGACTTCAAGCTGCTGCCCTGGCCGCGCGCCAGCGAGGGCTACC
GGCACCTCCAGGAGTACCTGACGCTGCCGGAGAAGTTCCTGTTCTTCGAGGTGCGCGGGCTGGACGCCGC
CGCCGGGCTGAAAGAGGACCGCTTCGAGATTGCCTTCCACCTGGAGCGGCCGCCGCCCCTGGATGCGCGC
ATCCACCGGGAGATGTTCCGGCTACATTGCGCCCCCGTGGTGAACCTCTTCAGCGTGCCGGCGGACCCCA
TCCTCCACCGCACGCTGGACCGGGAGCACCTGCTGCGCGCGTCCGACCTGCCCCCCAACCACGCGGAGAT
TTACTCGGTGGACTCGGTGACGGGCCTGAAGGCCGGACGCAACGAGCGGCGCGTCTACCGGCCCTTCTAC
GAGTTCACCCACACCGCGGGCGGGGACGCCGAGCAGTCCTTCTATCGGCTGCGCCGGGCGCCTTCGCCGC
TGGACGAAGGAATCGACACGTACATTACGCTGGAGACGCCGCGGAACATCGCGCCGGAGGTCAACGCCGA
GGAAGCGCTGTCCATGGACCTGACGTGCACCAACCGCTCGCTGCCCTCGCGGCTGCAGGTGGGTGACTTG
ACGGCATCCACCTCCGCCAGCCCCACGCAGGCGAAGTTCAAGAACATCTCCCCGGTGAGCCGGCCCGCGC
GCGCGCCGCTGGGCACCGAACTGCACTGGCGGCTCCTGTCGCACCTGGCCATCAACCAGCACTCGCTGGC
GGACGCGGCCGCACTGCGGCGGCTGATGGACCTGTACAACTTCCATTCGCTCACCGACAACCTGGCGGCG
CGCGCCAGCCGCCTGCGCATCAACGCCATCCGCGCGGTGGAGACGAAGCCGGTGACGCGCTTCCTGGAGG
GCGCGCCGCTGCGGGGTCACCGCACCCGCGTGGACCTGGACGAAGAGAACTTCATGGGCGTGGGCGATTC
GTTCCTCTTCGGCTCCGTGCTGGAGGAACTGCTCGCCTCCCACGTCACCATCAACTCCTTCAACGAGCTG
AGCATCCGGCTTCACCCCTCGCAGACGGAGTTCGCGTGGCTTCCGAGGAACGGCTCCCAGACGCTTTTGT
AG
 Primer design