SecReT6
Protein ID: 108758075
SecReT6 ID127
T6SS typei1
Gene symbolclpB
Locus tagMXAN_4813
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6021917..6024574 [+]
ProductATP-dependent chaperone protein ClpB
NoteTssH
UniProt IDQ1D2Z9
KEGG IDmxa:MXAN_4813
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 230..251
AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 616..781
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 232..337
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 620..742
ClpB_D2-small [PF10431], Evalue: 4.10E-15, Aligned region: 789..860
AAA_5 [PF07728], Evalue: 6.70E-12, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 6.70E-12, Aligned region: 620..741
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 116..157
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 209..248
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 275..310
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 491..491
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 611..643
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 684..714
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 783..806
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 231..313
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 374..398
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 618..642
AAA_25 [PF13481], Evalue: 9.00E-07, Aligned region: 20..81
AAA_25 [PF13481], Evalue: 9.00E-07, Aligned region: 232..257
AAA_25 [PF13481], Evalue: 9.00E-07, Aligned region: 489..543
AAA_25 [PF13481], Evalue: 9.00E-07, Aligned region: 618..652
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 225..255
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 620..640
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 730..752
AAA_19 [PF13245], Evalue: 3.00E-05, Aligned region: 229..252
AAA_19 [PF13245], Evalue: 3.00E-05, Aligned region: 620..642
NACHT [PF05729], Evalue: 4.10E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 4.10E-05, Aligned region: 619..655
NACHT [PF05729], Evalue: 4.10E-05, Aligned region: 849..873
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 232..252
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 534..572
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 621..643
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 210..246
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 285..315
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 619..632
AAA_18 [PF13238], Evalue: 0.00047, Aligned region: 232..251
AAA_18 [PF13238], Evalue: 0.00047, Aligned region: 622..650
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 226..251
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 618..645
Sigma54_activat [PF00158], Evalue: 0.00096, Aligned region: 215..246
Sigma54_activat [PF00158], Evalue: 0.00096, Aligned region: 619..720
RuvB_N [PF05496], Evalue: 0.0013, Aligned region: 231..249
RuvB_N [PF05496], Evalue: 0.0013, Aligned region: 302..312
RuvB_N [PF05496], Evalue: 0.0013, Aligned region: 581..641
DUF258 [PF03193], Evalue: 0.0016, Aligned region: 208..249
DUF258 [PF03193], Evalue: 0.0016, Aligned region: 619..632
AAA_23 [PF13476], Evalue: 0.0017, Aligned region: 232..260
AAA_23 [PF13476], Evalue: 0.0017, Aligned region: 618..646
RNA_helicase [PF00910], Evalue: 0.0041, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0041, Aligned region: 621..642
AAA_33 [PF13671], Evalue: 0.0042, Aligned region: 232..249
AAA_33 [PF13671], Evalue: 0.0042, Aligned region: 453..492
AAA_33 [PF13671], Evalue: 0.0042, Aligned region: 505..535
AAA_33 [PF13671], Evalue: 0.0042, Aligned region: 619..641
ResIII [PF04851], Evalue: 0.0054, Aligned region: 216..249
ResIII [PF04851], Evalue: 0.0054, Aligned region: 302..313
ResIII [PF04851], Evalue: 0.0054, Aligned region: 591..642
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 99..116
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 231..246
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 299..317
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 500..533
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 620..647
FtsK_SpoIIIE [PF01580], Evalue: 0.0064, Aligned region: 226..271
FtsK_SpoIIIE [PF01580], Evalue: 0.0064, Aligned region: 450..538
FtsK_SpoIIIE [PF01580], Evalue: 0.0064, Aligned region: 619..640
TIP49 [PF06068], Evalue: 0.0083, Aligned region: 232..252
TIP49 [PF06068], Evalue: 0.0083, Aligned region: 280..311
TIP49 [PF06068], Evalue: 0.0083, Aligned region: 617..655
Zeta_toxin [PF06414], Evalue: 0.0089, Aligned region: 226..247
Zeta_toxin [PF06414], Evalue: 0.0089, Aligned region: 619..660
MobB [PF03205], Evalue: 0.009, Aligned region: 233..255
MobB [PF03205], Evalue: 0.009, Aligned region: 619..642
Protein Sequence: 885 a.a.     [Download]
>gi|108758075|ref|YP_632974.1| ATP-dependent chaperone protein ClpB [Myxococcus xanthus DK 1622]
MGAPIRVDPKALVRRLTPTSTRLLEAAVARASAGRFYEIVPEHMLVQMLEPEDSDVARILQQFGVDRRHL
LASMERALQGLRAGSSGRPVFSETLFQWFEEAWLLASVEQGATRLRSGLLFAQFVSRRARYTAELFPELD
AISRDELMSSLDVVLRPSPENVEVASADAAASGAAGGAASGAGGRGDEALKRFATSFTGRVREGKIDPIF
GRHREIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLAWAIVRGEVPDALKNVELLGLDLGLLQAGAGV
RGEFENRLKAVISEVKASPTPIILFIDEAHTIIGAGGSQGGTDASNLLKPALARGELRTLAATTWAEYKK
YFEKDAALERRFQPVKVEEPSEEDAELMLRGLRPTYEAAHGVIIRDEAVTAAVRLSSRYISGRQLPDKAV
DLLDTSAARVKIELSTRPEELVQLDQEISALERERDTRKRDLAEGTGGPDEQTSLEAAEAKLSATVDARA
TLHARWETERTAVAALMEARKALREAAPDTDSAPLKAAVDEAAAKLAATRGEVPLVHADVDADIVARVVA
GWTGVPVGKMRSDLLESVLNLEDKLRGRVRGQEAALKKVAEIIRISQAGIRNPDTPIGVMLFVGPSGVGK
TETALALADALYGGERFMTTLNMSEFQEKHTVSRLIGSPPGYVGYGEGGLLTEAVRQRPYSVVLLDECEK
ADLEVMNLFYQVFDKGSLTDGEGRAVDFKNTVLILTSNLASDLVMRMFEDGAQPTSDEVLSVIRPALSQH
FKPALLARMTVVPFGPVQRDVMRQIAEMKLAKLVSRLRTAHNVETTLAPELLDELARRCTESEMGARNME
QILQGSLMPALSRELLQHLVSGAVPPKLHVALTEGGDWDLRFAEA
 
Nucleotide Sequence: 2658 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6021917-6024574 Myxococcus xanthus DK 1622 chromosome, complete genome
TTGGGGGCTCCCATTCGCGTCGATCCGAAAGCGCTCGTCCGTCGCCTGACGCCCACCTCTACCCGTCTGC
TCGAGGCCGCCGTGGCCCGGGCCAGCGCGGGACGGTTCTATGAAATCGTCCCGGAGCACATGCTGGTGCA
GATGCTGGAGCCGGAGGACTCGGACGTCGCGCGCATCCTCCAGCAGTTCGGCGTGGACCGCCGCCACCTG
CTGGCCAGCATGGAGCGCGCCCTCCAGGGCCTGCGCGCGGGCAGCTCCGGCCGGCCCGTCTTCTCCGAGA
CGCTGTTCCAGTGGTTCGAGGAAGCGTGGCTCCTGGCTTCCGTGGAGCAGGGCGCCACGCGGCTGCGCTC
GGGCCTGCTGTTCGCCCAGTTCGTCAGCCGGCGCGCGCGCTACACCGCGGAGCTGTTCCCCGAGCTGGAC
GCCATCAGCCGCGACGAGCTGATGAGCTCGCTGGACGTGGTGCTGCGGCCCTCGCCCGAGAATGTCGAGG
TCGCCTCCGCGGATGCCGCCGCCAGTGGCGCCGCGGGAGGCGCGGCCAGTGGCGCGGGCGGCCGTGGGGA
TGAAGCCCTCAAGCGCTTCGCCACGTCCTTCACCGGCCGGGTGCGCGAGGGGAAGATCGACCCCATCTTC
GGCCGGCACCGCGAAATCCGGCAGATGGTGGACATCCTCTCCCGCCGCCGGAAGAACAACCCCATCCTGG
TGGGCGAGCCCGGCGTGGGCAAGACGGCGCTGGTGGAGGGCCTGGCCTGGGCCATCGTCCGGGGCGAGGT
GCCCGACGCGCTGAAGAACGTGGAGCTGCTGGGGCTGGACCTGGGCCTGCTCCAGGCGGGCGCGGGCGTG
CGCGGCGAGTTCGAGAACCGCCTCAAGGCCGTCATCTCCGAGGTGAAGGCCTCCCCCACCCCCATCATCC
TGTTCATCGACGAGGCGCACACCATCATCGGCGCGGGCGGCTCGCAGGGCGGCACGGACGCGTCCAACCT
GCTCAAGCCGGCGCTGGCGCGCGGTGAGCTGCGCACGCTCGCGGCCACCACCTGGGCCGAGTACAAGAAG
TACTTCGAGAAGGACGCCGCGCTGGAGCGGCGCTTCCAGCCGGTCAAGGTGGAGGAGCCCAGCGAGGAGG
ACGCGGAGCTGATGCTGCGCGGCCTGCGCCCCACGTACGAAGCGGCCCACGGCGTCATCATCCGCGACGA
AGCCGTCACCGCCGCGGTGCGCCTGTCCAGCCGGTACATCTCCGGCCGGCAGCTCCCGGACAAGGCGGTG
GACCTGCTGGACACGTCCGCGGCCCGCGTGAAGATTGAGCTGTCCACCCGGCCCGAGGAGCTGGTGCAAC
TGGACCAGGAGATTTCGGCGCTGGAGCGCGAGCGCGACACGCGCAAGCGCGACCTCGCCGAGGGCACGGG
CGGCCCGGACGAACAGACGTCCCTGGAGGCCGCCGAGGCGAAGCTGAGCGCCACGGTGGATGCACGAGCC
ACGCTGCATGCGCGCTGGGAGACGGAGCGTACGGCCGTCGCGGCGCTGATGGAGGCCCGCAAGGCCCTGC
GCGAGGCCGCTCCGGACACGGACTCCGCGCCACTGAAGGCGGCCGTGGACGAAGCTGCGGCGAAGCTGGC
GGCCACGCGCGGCGAGGTGCCGCTGGTACACGCGGACGTGGACGCGGACATCGTCGCGCGGGTGGTGGCG
GGCTGGACGGGCGTGCCCGTGGGGAAGATGCGCAGCGACCTGCTGGAGTCGGTGCTCAACCTGGAGGACA
AGCTCCGGGGCCGGGTGCGGGGCCAGGAGGCGGCGCTGAAGAAGGTTGCGGAAATCATCCGCATCTCCCA
GGCCGGCATCCGCAACCCGGACACGCCCATTGGCGTGATGCTCTTCGTGGGCCCCAGCGGCGTGGGCAAG
ACGGAGACGGCGCTGGCGCTGGCGGACGCGCTCTATGGCGGCGAGCGCTTCATGACGACGCTCAACATGA
GCGAGTTCCAGGAGAAGCACACGGTGAGCCGGCTCATCGGCTCGCCGCCGGGCTACGTGGGATACGGCGA
GGGCGGCCTGCTGACGGAAGCCGTGCGTCAGCGGCCCTACTCCGTCGTGCTGCTGGACGAGTGCGAGAAG
GCCGACCTGGAGGTGATGAACCTCTTCTACCAGGTGTTCGACAAGGGCTCGCTGACGGACGGCGAGGGCC
GCGCGGTGGACTTCAAGAACACCGTGCTCATCCTCACCAGCAACCTGGCCTCGGACCTGGTGATGCGGAT
GTTCGAGGACGGCGCGCAGCCCACCTCCGATGAGGTGCTGTCGGTGATTCGCCCCGCGCTCAGCCAGCAC
TTCAAGCCGGCGCTGCTGGCTCGAATGACGGTCGTCCCCTTCGGGCCGGTGCAGCGCGACGTGATGCGCC
AGATTGCCGAGATGAAGCTGGCCAAGCTGGTGAGCCGGCTGCGCACGGCGCACAACGTGGAGACGACGCT
GGCGCCAGAGTTGCTGGACGAGCTTGCGCGCCGCTGCACGGAGTCGGAGATGGGGGCGCGCAACATGGAG
CAGATTCTCCAGGGCTCGCTGATGCCGGCGCTGTCCCGCGAGTTGCTGCAGCACCTGGTGAGCGGCGCGG
TGCCCCCGAAGCTGCATGTGGCCCTGACCGAGGGAGGCGACTGGGACCTCCGGTTCGCCGAGGCCTGA
 Primer design