SecReT6
Protein ID: 108758075
SecReT6 ID127
T6SS typei1
Gene symbolclpB
Locus tagMXAN_4813
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6021917..6024574 [+]
ProductATP-dependent chaperone protein ClpB
NoteTssH
UniProt IDQ1D2Z9
KEGG IDmxa:MXAN_4813
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 230..251
AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 616..781
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 232..337
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 620..742
ClpB_D2-small [PF10431], Evalue: 4.10E-15, Aligned region: 789..860
AAA_5 [PF07728], Evalue: 6.70E-12, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 6.70E-12, Aligned region: 620..741
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 116..157
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 209..248
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 275..310
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 491..491
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 611..643
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 684..714
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 783..806
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 231..313
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 374..398
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 618..642
AAA_25 [PF13481], Evalue: 9.00E-07, Aligned region: 20..81
AAA_25 [PF13481], Evalue: 9.00E-07, Aligned region: 232..257
AAA_25 [PF13481], Evalue: 9.00E-07, Aligned region: 489..543
AAA_25 [PF13481], Evalue: 9.00E-07, Aligned region: 618..652
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 225..255
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 620..640
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 730..752
AAA_19 [PF13245], Evalue: 3.00E-05, Aligned region: 229..252
AAA_19 [PF13245], Evalue: 3.00E-05, Aligned region: 620..642
NACHT [PF05729], Evalue: 4.10E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 4.10E-05, Aligned region: 619..655
NACHT [PF05729], Evalue: 4.10E-05, Aligned region: 849..873
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 232..252
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 534..572
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 621..643
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 210..246
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 285..315
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 619..632
AAA_18 [PF13238], Evalue: 0.00047, Aligned region: 232..251
AAA_18 [PF13238], Evalue: 0.00047, Aligned region: 622..650
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 226..251
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 618..645
Sigma54_activat [PF00158], Evalue: 0.00096, Aligned region: 215..246
Sigma54_activat [PF00158], Evalue: 0.00096, Aligned region: 619..720
RuvB_N [PF05496], Evalue: 0.0013, Aligned region: 231..249
RuvB_N [PF05496], Evalue: 0.0013, Aligned region: 302..312
RuvB_N [PF05496], Evalue: 0.0013, Aligned region: 581..641
DUF258 [PF03193], Evalue: 0.0016, Aligned region: 208..249
DUF258 [PF03193], Evalue: 0.0016, Aligned region: 619..632
AAA_23 [PF13476], Evalue: 0.0017, Aligned region: 232..260
AAA_23 [PF13476], Evalue: 0.0017, Aligned region: 618..646
RNA_helicase [PF00910], Evalue: 0.0041, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0041, Aligned region: 621..642
AAA_33 [PF13671], Evalue: 0.0042, Aligned region: 232..249
AAA_33 [PF13671], Evalue: 0.0042, Aligned region: 453..492
AAA_33 [PF13671], Evalue: 0.0042, Aligned region: 505..535
AAA_33 [PF13671], Evalue: 0.0042, Aligned region: 619..641
ResIII [PF04851], Evalue: 0.0054, Aligned region: 216..249
ResIII [PF04851], Evalue: 0.0054, Aligned region: 302..313
ResIII [PF04851], Evalue: 0.0054, Aligned region: 591..642
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 99..116
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 231..246
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 299..317
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 500..533
AAA_10 [PF12846], Evalue: 0.0056, Aligned region: 620..647
FtsK_SpoIIIE [PF01580], Evalue: 0.0064, Aligned region: 226..271
FtsK_SpoIIIE [PF01580], Evalue: 0.0064, Aligned region: 450..538
FtsK_SpoIIIE [PF01580], Evalue: 0.0064, Aligned region: 619..640
TIP49 [PF06068], Evalue: 0.0083, Aligned region: 232..252
TIP49 [PF06068], Evalue: 0.0083, Aligned region: 280..311
TIP49 [PF06068], Evalue: 0.0083, Aligned region: 617..655
Zeta_toxin [PF06414], Evalue: 0.0089, Aligned region: 226..247
Zeta_toxin [PF06414], Evalue: 0.0089, Aligned region: 619..660
MobB [PF03205], Evalue: 0.009, Aligned region: 233..255
MobB [PF03205], Evalue: 0.009, Aligned region: 619..642
Protein Sequence: 885 a.a.     [Download]
>gi|108758075|ref|YP_632974.1| ATP-dependent chaperone protein ClpB [Myxococcus xanthus DK 1622]
MGAPIRVDPKALVRRLTPTSTRLLEAAVARASAGRFYEIVPEHMLVQMLEPEDSDVARILQQFGVDRRHL
LASMERALQGLRAGSSGRPVFSETLFQWFEEAWLLASVEQGATRLRSGLLFAQFVSRRARYTAELFPELD
AISRDELMSSLDVVLRPSPENVEVASADAAASGAAGGAASGAGGRGDEALKRFATSFTGRVREGKIDPIF
GRHREIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLAWAIVRGEVPDALKNVELLGLDLGLLQAGAGV
RGEFENRLKAVISEVKASPTPIILFIDEAHTIIGAGGSQGGTDASNLLKPALARGELRTLAATTWAEYKK
YFEKDAALERRFQPVKVEEPSEEDAELMLRGLRPTYEAAHGVIIRDEAVTAAVRLSSRYISGRQLPDKAV
DLLDTSAARVKIELSTRPEELVQLDQEISALERERDTRKRDLAEGTGGPDEQTSLEAAEAKLSATVDARA
TLHARWETERTAVAALMEARKALREAAPDTDSAPLKAAVDEAAAKLAATRGEVPLVHADVDADIVARVVA
GWTGVPVGKMRSDLLESVLNLEDKLRGRVRGQEAALKKVAEIIRISQAGIRNPDTPIGVMLFVGPSGVGK
TETALALADALYGGERFMTTLNMSEFQEKHTVSRLIGSPPGYVGYGEGGLLTEAVRQRPYSVVLLDECEK
ADLEVMNLFYQVFDKGSLTDGEGRAVDFKNTVLILTSNLASDLVMRMFEDGAQPTSDEVLSVIRPALSQH
FKPALLARMTVVPFGPVQRDVMRQIAEMKLAKLVSRLRTAHNVETTLAPELLDELARRCTESEMGARNME
QILQGSLMPALSRELLQHLVSGAVPPKLHVALTEGGDWDLRFAEA
 
Nucleotide Sequence: 2658 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6021917-6024574 Myxococcus xanthus DK 1622 chromosome, complete genome
TTGGGGGCTCCCATTCGCGTCGATCCGAAAGCGCTCGTCCGTCGCCTGACGCCCACCTCTACCCGTCTGC
TCGAGGCCGCCGTGGCCCGGGCCAGCGCGGGACGGTTCTATGAAATCGTCCCGGAGCACATGCTGGTGCA
GATGCTGGAGCCGGAGGACTCGGACGTCGCGCGCATCCTCCAGCAGTTCGGCGTGGACCGCCGCCACCTG
CTGGCCAGCATGGAGCGCGCCCTCCAGGGCCTGCGCGCGGGCAGCTCCGGCCGGCCCGTCTTCTCCGAGA
CGCTGTTCCAGTGGTTCGAGGAAGCGTGGCTCCTGGCTTCCGTGGAGCAGGGCGCCACGCGGCTGCGCTC
GGGCCTGCTGTTCGCCCAGTTCGTCAGCCGGCGCGCGCGCTACACCGCGGAGCTGTTCCCCGAGCTGGAC
GCCATCAGCCGCGACGAGCTGATGAGCTCGCTGGACGTGGTGCTGCGGCCCTCGCCCGAGAATGTCGAGG
TCGCCTCCGCGGATGCCGCCGCCAGTGGCGCCGCGGGAGGCGCGGCCAGTGGCGCGGGCGGCCGTGGGGA
TGAAGCCCTCAAGCGCTTCGCCACGTCCTTCACCGGCCGGGTGCGCGAGGGGAAGATCGACCCCATCTTC
GGCCGGCACCGCGAAATCCGGCAGATGGTGGACATCCTCTCCCGCCGCCGGAAGAACAACCCCATCCTGG
TGGGCGAGCCCGGCGTGGGCAAGACGGCGCTGGTGGAGGGCCTGGCCTGGGCCATCGTCCGGGGCGAGGT
GCCCGACGCGCTGAAGAACGTGGAGCTGCTGGGGCTGGACCTGGGCCTGCTCCAGGCGGGCGCGGGCGTG
CGCGGCGAGTTCGAGAACCGCCTCAAGGCCGTCATCTCCGAGGTGAAGGCCTCCCCCACCCCCATCATCC
TGTTCATCGACGAGGCGCACACCATCATCGGCGCGGGCGGCTCGCAGGGCGGCACGGACGCGTCCAACCT
GCTCAAGCCGGCGCTGGCGCGCGGTGAGCTGCGCACGCTCGCGGCCACCACCTGGGCCGAGTACAAGAAG
TACTTCGAGAAGGACGCCGCGCTGGAGCGGCGCTTCCAGCCGGTCAAGGTGGAGGAGCCCAGCGAGGAGG
ACGCGGAGCTGATGCTGCGCGGCCTGCGCCCCACGTACGAAGCGGCCCACGGCGTCATCATCCGCGACGA
AGCCGTCACCGCCGCGGTGCGCCTGTCCAGCCGGTACATCTCCGGCCGGCAGCTCCCGGACAAGGCGGTG
GACCTGCTGGACACGTCCGCGGCCCGCGTGAAGATTGAGCTGTCCACCCGGCCCGAGGAGCTGGTGCAAC
TGGACCAGGAGATTTCGGCGCTGGAGCGCGAGCGCGACACGCGCAAGCGCGACCTCGCCGAGGGCACGGG
CGGCCCGGACGAACAGACGTCCCTGGAGGCCGCCGAGGCGAAGCTGAGCGCCACGGTGGATGCACGAGCC
ACGCTGCATGCGCGCTGGGAGACGGAGCGTACGGCCGTCGCGGCGCTGATGGAGGCCCGCAAGGCCCTGC
GCGAGGCCGCTCCGGACACGGACTCCGCGCCACTGAAGGCGGCCGTGGACGAAGCTGCGGCGAAGCTGGC
GGCCACGCGCGGCGAGGTGCCGCTGGTACACGCGGACGTGGACGCGGACATCGTCGCGCGGGTGGTGGCG
GGCTGGACGGGCGTGCCCGTGGGGAAGATGCGCAGCGACCTGCTGGAGTCGGTGCTCAACCTGGAGGACA
AGCTCCGGGGCCGGGTGCGGGGCCAGGAGGCGGCGCTGAAGAAGGTTGCGGAAATCATCCGCATCTCCCA
GGCCGGCATCCGCAACCCGGACACGCCCATTGGCGTGATGCTCTTCGTGGGCCCCAGCGGCGTGGGCAAG
ACGGAGACGGCGCTGGCGCTGGCGGACGCGCTCTATGGCGGCGAGCGCTTCATGACGACGCTCAACATGA
GCGAGTTCCAGGAGAAGCACACGGTGAGCCGGCTCATCGGCTCGCCGCCGGGCTACGTGGGATACGGCGA
GGGCGGCCTGCTGACGGAAGCCGTGCGTCAGCGGCCCTACTCCGTCGTGCTGCTGGACGAGTGCGAGAAG
GCCGACCTGGAGGTGATGAACCTCTTCTACCAGGTGTTCGACAAGGGCTCGCTGACGGACGGCGAGGGCC
GCGCGGTGGACTTCAAGAACACCGTGCTCATCCTCACCAGCAACCTGGCCTCGGACCTGGTGATGCGGAT
GTTCGAGGACGGCGCGCAGCCCACCTCCGATGAGGTGCTGTCGGTGATTCGCCCCGCGCTCAGCCAGCAC
TTCAAGCCGGCGCTGCTGGCTCGAATGACGGTCGTCCCCTTCGGGCCGGTGCAGCGCGACGTGATGCGCC
AGATTGCCGAGATGAAGCTGGCCAAGCTGGTGAGCCGGCTGCGCACGGCGCACAACGTGGAGACGACGCT
GGCGCCAGAGTTGCTGGACGAGCTTGCGCGCCGCTGCACGGAGTCGGAGATGGGGGCGCGCAACATGGAG
CAGATTCTCCAGGGCTCGCTGATGCCGGCGCTGTCCCGCGAGTTGCTGCAGCACCTGGTGAGCGGCGCGG
TGCCCCCGAAGCTGCATGTGGCCCTGACCGAGGGAGGCGACTGGGACCTCCGGTTCGCCGAGGCCTGA
 Primer design

Protein ID: 108761992
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4823
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6032464..6035913 [+]
ProductClpB family protein
NoteTssH
UniProt IDQ1D2Y9
KEGG IDmxa:MXAN_4823
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-32, Aligned region: 290..334
AAA_2 [PF07724], Evalue: 1.20E-32, Aligned region: 560..723
AAA [PF00004], Evalue: 2.20E-15, Aligned region: 289..386
AAA [PF00004], Evalue: 2.20E-15, Aligned region: 565..646
AAA_5 [PF07728], Evalue: 3.20E-15, Aligned region: 288..318
AAA_5 [PF07728], Evalue: 3.20E-15, Aligned region: 565..665
ClpB_D2-small [PF10431], Evalue: 5.30E-13, Aligned region: 735..802
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 269..423
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 535..589
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 621..648
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 870..924
AAA_17 [PF13207], Evalue: 8.50E-10, Aligned region: 289..313
AAA_17 [PF13207], Evalue: 8.50E-10, Aligned region: 565..601
AAA_17 [PF13207], Evalue: 8.50E-10, Aligned region: 877..937
AAA_33 [PF13671], Evalue: 4.30E-09, Aligned region: 289..411
AAA_33 [PF13671], Evalue: 4.30E-09, Aligned region: 564..587
AAA_18 [PF13238], Evalue: 2.80E-07, Aligned region: 289..310
AAA_18 [PF13238], Evalue: 2.80E-07, Aligned region: 567..594
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 285..321
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 563..586
IstB_IS21 [PF01695], Evalue: 1.30E-06, Aligned region: 274..309
IstB_IS21 [PF01695], Evalue: 1.30E-06, Aligned region: 565..584
DUF258 [PF03193], Evalue: 3.70E-06, Aligned region: 287..314
DUF258 [PF03193], Evalue: 3.70E-06, Aligned region: 564..583
AAA_23 [PF13476], Evalue: 3.70E-06, Aligned region: 289..310
AAA_23 [PF13476], Evalue: 3.70E-06, Aligned region: 563..606
AAA_23 [PF13476], Evalue: 3.70E-06, Aligned region: 882..948
Sigma54_activat [PF00158], Evalue: 5.60E-06, Aligned region: 280..309
Sigma54_activat [PF00158], Evalue: 5.60E-06, Aligned region: 560..661
AAA_29 [PF13555], Evalue: 5.70E-06, Aligned region: 288..314
AAA_29 [PF13555], Evalue: 5.70E-06, Aligned region: 563..590
AAA_28 [PF13521], Evalue: 8.80E-06, Aligned region: 289..320
AAA_28 [PF13521], Evalue: 8.80E-06, Aligned region: 566..585
ABC_tran [PF00005], Evalue: 1.30E-05, Aligned region: 282..311
ABC_tran [PF00005], Evalue: 1.30E-05, Aligned region: 565..586
MobB [PF03205], Evalue: 3.70E-05, Aligned region: 289..310
MobB [PF03205], Evalue: 3.70E-05, Aligned region: 564..594
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 288..326
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 565..586
RNA_helicase [PF00910], Evalue: 0.00015, Aligned region: 289..313
RNA_helicase [PF00910], Evalue: 0.00015, Aligned region: 566..587
AAA_14 [PF13173], Evalue: 0.00019, Aligned region: 287..311
AAA_14 [PF13173], Evalue: 0.00019, Aligned region: 564..647
AAA_19 [PF13245], Evalue: 0.00043, Aligned region: 283..312
AAA_19 [PF13245], Evalue: 0.00043, Aligned region: 565..589
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 283..313
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 548..585
AAA_30 [PF13604], Evalue: 0.00071, Aligned region: 281..312
AAA_30 [PF13604], Evalue: 0.00071, Aligned region: 564..589
Mg_chelatase [PF01078], Evalue: 0.00072, Aligned region: 281..318
Mg_chelatase [PF01078], Evalue: 0.00072, Aligned region: 565..589
AAA_25 [PF13481], Evalue: 0.00088, Aligned region: 288..311
AAA_25 [PF13481], Evalue: 0.00088, Aligned region: 557..583
SRP54 [PF00448], Evalue: 0.00094, Aligned region: 289..311
SRP54 [PF00448], Evalue: 0.00094, Aligned region: 564..590
AAA_3 [PF07726], Evalue: 0.00097, Aligned region: 289..312
AAA_3 [PF07726], Evalue: 0.00097, Aligned region: 568..676
Arch_ATPase [PF01637], Evalue: 0.0019, Aligned region: 280..314
Arch_ATPase [PF01637], Evalue: 0.0019, Aligned region: 564..586
Zeta_toxin [PF06414], Evalue: 0.0021, Aligned region: 289..311
Zeta_toxin [PF06414], Evalue: 0.0021, Aligned region: 560..600
AAA_10 [PF12846], Evalue: 0.0025, Aligned region: 290..311
AAA_10 [PF12846], Evalue: 0.0025, Aligned region: 565..603
AAA_10 [PF12846], Evalue: 0.0025, Aligned region: 835..923
Sigma54_activ_2 [PF14532], Evalue: 0.0038, Aligned region: 281..309
Sigma54_activ_2 [PF14532], Evalue: 0.0038, Aligned region: 548..584
T2SE [PF00437], Evalue: 0.0039, Aligned region: 272..312
T2SE [PF00437], Evalue: 0.0039, Aligned region: 562..595
UPF0079 [PF02367], Evalue: 0.004, Aligned region: 284..311
UPF0079 [PF02367], Evalue: 0.004, Aligned region: 564..591
MMR_HSR1 [PF01926], Evalue: 0.0065, Aligned region: 289..316
MMR_HSR1 [PF01926], Evalue: 0.0065, Aligned region: 566..583
Bac_DnaA [PF00308], Evalue: 0.0086, Aligned region: 282..311
Bac_DnaA [PF00308], Evalue: 0.0086, Aligned region: 565..585
PduV-EutP [PF10662], Evalue: 0.0092, Aligned region: 289..308
PduV-EutP [PF10662], Evalue: 0.0092, Aligned region: 565..584
Protein Sequence: 1149 a.a.     [Download]
>gi|108761992|ref|YP_632984.1| ClpB family protein [Myxococcus xanthus DK 1622]
MPSRTAPFSPESSPMNFRFQCWLQRHVSGRVTLTPLALRRLAVHADSLEAATEELTLALDDQLSRVHPRR
VPEFIAPTGGALETVELPAIPVWGAEENHFAPLTLSAVVAPTLNAFLGLHAPRLNSHHWFQSKTLPAEAS
ELLGDRLEGMSDAERLALRPDGPESLLEIEVRATPVALSELTPRELHRNIRPPPRPPDAPADLDDDTRED
GEDEDTEALDLDSWEPRRRTAHRGPGEPPAKPPPTPTLDSVGVAWHRLAQEGQLDAAYEQDALVALLRTR
LAAKDAEPVVLVGPSGVGKTSVLHALAQSLRAPTATEAERARPFYFLDGSRLIAGEGFFGDWQQQVLRAF
REATEARALLSLGHAVELLDAGKSAHSDQNVAQLLLPLLAARDVAVMAEATEETWAQVEQRNTSFARLFS
VVRVAEPTPDALGRIVAKVAEDDALAAAMQVQPDALDEARFLCRRFLPYGAQVGNTVAFVRRLLASCAQA
SRTSVTRLEATRQFASESGIPEHLLRDDQPLASAHVRDFLASRVMGQDAAVERAASVVSVLKAGMSDVRR
PLGVLLFVGPTGVGKTELSKALAELLFGAKERMVRLDMGEYAGPDALLRLMGDGETPGYLTSAVRRQPFC
VVLLDEVEKAHPAVHDALLGVLGEGRLTDASGRFTDFRNALIILTSNLGADTLRARVGFDASGGAPDMAS
LRAHYLSEVQRFFRPEMFNRMDDVVVFSPLSAPLLRRLVVRELEAVCRRPGLSLHDALLEVTPAAQDWLA
LRGFDARYGARPLKRALERELVVPVADWLAAHPRMGPANLTVDAGTTGLELRAESLGGAAEGGGREAIER
ILEEAATVRAEVQRWSRCAPMHSLRRVLAVFDKVSRHTAYWEERALAEENSRKSSEARALEQSLRECAQQ
AEAIEDLLFEAHLSRTVDQVESLSREVSQVKAAFARIRQRIYSSLFPPSHGATLYLVPGRGAWRQARMLA
AAYEGWAQKASMEKRRGLLAVPERKSGEKAHRTPPPPQWRWADDETFDKLVVQPVAYAIQVKGGPHALLL
AGEHGLHRFIEGSQISMVHAYFEPRPLSLFDLSSREALQKQLPKNEVRQVRLSGSGSGQGTLTDLRTGVQ
QRFGLEGPDLEPLLEPWMQWRVFNSRDED
 
Nucleotide Sequence: 3450 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6032464-6035913 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGCCGTCACGCACGGCACCGTTTTCACCCGAGTCCTCACCCATGAACTTCCGTTTTCAATGCTGGTTGC
AGCGGCACGTCAGCGGCCGGGTGACGCTCACGCCGCTGGCGCTGCGCCGTCTCGCGGTGCACGCGGACTC
GCTGGAGGCCGCCACCGAGGAGCTGACGCTCGCGCTGGACGACCAACTCTCCCGCGTCCACCCGCGGCGC
GTGCCGGAGTTCATCGCCCCCACCGGAGGGGCGCTCGAAACGGTGGAGCTACCCGCGATTCCCGTCTGGG
GCGCCGAGGAGAATCACTTCGCGCCGCTGACGTTGTCCGCCGTGGTGGCCCCCACGCTCAATGCCTTCCT
GGGCCTCCACGCGCCACGCCTCAACAGCCATCACTGGTTCCAGAGCAAGACACTCCCCGCCGAGGCCTCG
GAGCTGCTGGGAGATCGCCTGGAGGGAATGTCCGACGCGGAGCGCCTTGCCCTGCGTCCGGATGGACCTG
AGTCCCTGCTGGAAATCGAAGTGCGGGCCACCCCCGTGGCCCTGTCGGAGCTCACGCCTCGCGAGCTGCA
CCGGAACATTCGTCCACCGCCGCGCCCTCCAGACGCACCCGCCGACCTGGATGACGACACGCGCGAGGAC
GGCGAGGACGAAGACACGGAGGCGCTGGACCTGGACAGCTGGGAGCCACGCCGCCGCACCGCGCATCGAG
GCCCGGGTGAGCCGCCCGCGAAGCCGCCGCCTACGCCCACCCTGGACAGCGTCGGCGTGGCCTGGCACCG
GCTCGCGCAGGAAGGACAGCTCGACGCGGCCTACGAGCAGGATGCGCTCGTCGCCCTGCTCCGGACCCGG
CTCGCGGCCAAGGACGCCGAACCGGTGGTCCTGGTGGGGCCTTCGGGCGTGGGCAAGACGTCGGTGCTCC
ACGCGCTCGCCCAGTCGCTGCGCGCCCCCACCGCCACCGAGGCCGAGCGCGCCCGCCCGTTCTACTTCCT
CGACGGAAGCCGGCTCATCGCGGGCGAGGGCTTCTTCGGAGACTGGCAGCAGCAGGTGCTGCGCGCCTTC
CGTGAGGCCACCGAGGCCCGGGCCCTGCTGTCCCTGGGCCATGCCGTGGAGCTCCTCGACGCGGGCAAGA
GCGCCCACAGTGACCAGAACGTGGCCCAACTGCTGCTCCCGCTCCTCGCGGCGCGTGACGTGGCCGTCAT
GGCCGAGGCCACGGAGGAGACCTGGGCCCAGGTGGAGCAGCGCAACACCAGCTTCGCCCGGCTCTTCTCG
GTGGTGCGCGTCGCGGAGCCCACGCCCGATGCGCTCGGCCGCATCGTCGCCAAGGTGGCGGAGGACGACG
CCTTGGCCGCCGCGATGCAGGTCCAGCCCGACGCGCTCGACGAGGCGCGCTTCCTGTGCCGCCGCTTCCT
GCCCTACGGTGCCCAGGTGGGCAACACCGTGGCCTTCGTGCGCCGGCTGCTGGCGTCCTGTGCCCAAGCC
TCGCGCACCTCCGTCACCCGACTGGAGGCCACCCGCCAATTCGCCTCGGAGTCCGGCATCCCCGAGCACC
TGCTCCGGGACGACCAGCCGCTGGCGTCCGCACACGTGCGCGACTTCCTGGCCTCGCGAGTGATGGGGCA
GGACGCCGCCGTGGAGCGCGCAGCCTCGGTGGTATCCGTCCTCAAGGCCGGCATGTCGGACGTGCGGCGC
CCGCTGGGGGTGCTGCTCTTCGTGGGCCCCACCGGCGTGGGCAAGACGGAGCTGTCCAAGGCGCTGGCGG
AGCTACTCTTCGGTGCGAAGGAGCGCATGGTCCGCCTGGACATGGGTGAGTACGCCGGTCCGGACGCCCT
GCTGCGGTTGATGGGAGACGGGGAGACGCCGGGCTACCTCACCTCGGCGGTGCGCCGGCAGCCCTTCTGC
GTGGTGCTGCTGGACGAGGTGGAGAAGGCCCACCCCGCCGTTCACGATGCGCTGCTGGGCGTCTTGGGCG
AAGGCCGCCTCACCGATGCCTCCGGGCGCTTCACGGACTTCCGCAACGCCCTCATCATCCTCACCAGCAA
CCTGGGCGCGGACACCCTGCGCGCCCGCGTGGGCTTCGATGCGTCGGGCGGTGCCCCGGACATGGCCTCC
CTGCGCGCGCACTACCTCTCCGAGGTGCAGCGCTTCTTCCGGCCGGAGATGTTCAACCGCATGGACGACG
TGGTCGTCTTCTCGCCGCTGTCCGCCCCGCTGCTGCGCCGGTTGGTGGTCCGCGAGCTTGAAGCCGTATG
CCGCCGTCCAGGCCTCTCGCTCCACGATGCCCTGCTGGAGGTCACCCCCGCCGCCCAGGACTGGCTGGCC
CTGAGAGGCTTCGACGCGCGGTATGGTGCCCGCCCCTTGAAGCGCGCGCTGGAGCGCGAGCTGGTGGTCC
CCGTGGCGGACTGGCTCGCGGCGCATCCCCGCATGGGGCCGGCGAACCTCACGGTGGACGCGGGAACCAC
GGGACTCGAACTGCGCGCCGAGTCCCTGGGCGGCGCCGCCGAGGGCGGGGGCCGGGAAGCCATCGAGCGG
ATCCTCGAGGAAGCAGCCACCGTGCGCGCGGAAGTCCAGCGTTGGAGCCGCTGCGCGCCCATGCACTCCC
TGCGCCGCGTCCTGGCCGTCTTCGACAAGGTCTCCCGGCACACCGCGTACTGGGAGGAGCGGGCGCTGGC
CGAAGAAAACTCGCGCAAGTCATCGGAGGCGCGAGCGCTGGAACAGTCGCTTCGGGAGTGCGCCCAGCAG
GCGGAGGCCATCGAGGACCTGCTCTTCGAGGCCCACCTGTCCAGGACCGTGGATCAGGTGGAGTCCCTGA
GCCGCGAGGTGAGCCAGGTGAAGGCGGCCTTCGCGCGCATCCGGCAACGCATCTACTCCTCCCTCTTTCC
CCCGTCACATGGCGCGACCCTCTACCTGGTGCCAGGTCGCGGCGCGTGGAGGCAGGCACGCATGCTCGCC
GCGGCCTATGAGGGGTGGGCCCAGAAGGCGTCCATGGAGAAGCGGCGAGGCCTGCTCGCCGTCCCCGAGC
GCAAGTCCGGCGAGAAGGCCCATCGCACCCCTCCGCCGCCGCAATGGCGGTGGGCCGACGATGAGACCTT
CGACAAGCTCGTCGTGCAGCCGGTCGCCTATGCGATTCAGGTCAAGGGCGGCCCCCACGCCCTGCTGCTC
GCTGGCGAGCACGGCCTGCATCGCTTCATCGAAGGCAGTCAGATTTCGATGGTGCATGCGTACTTCGAGC
CGCGGCCCCTCTCGCTGTTCGACCTCTCCTCCCGGGAGGCGTTGCAGAAGCAGTTGCCGAAAAACGAGGT
CCGTCAGGTGCGCCTGTCGGGCAGCGGTTCCGGCCAGGGGACGCTGACGGACCTTCGCACCGGGGTGCAG
CAGCGCTTCGGTCTGGAGGGGCCTGACCTGGAGCCCCTGCTGGAGCCCTGGATGCAGTGGCGCGTCTTCA
ACAGCCGGGACGAGGACTGA
 Primer design

Protein ID: 108759056
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4824
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6035918..6039301 [+]
ProductClpA/B family protein
NoteTssH
UniProt IDQ1D2Y8
KEGG IDmxa:MXAN_4824
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.90E-34, Aligned region: 256..289
AAA_2 [PF07724], Evalue: 9.90E-34, Aligned region: 533..691
AAA [PF00004], Evalue: 1.10E-17, Aligned region: 258..352
AAA [PF00004], Evalue: 1.10E-17, Aligned region: 538..629
AAA_5 [PF07728], Evalue: 2.60E-15, Aligned region: 257..331
AAA_5 [PF07728], Evalue: 2.60E-15, Aligned region: 538..649
ClpB_D2-small [PF10431], Evalue: 9.10E-15, Aligned region: 698..777
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 187..222
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 234..344
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 522..573
AAA_19 [PF13245], Evalue: 8.40E-08, Aligned region: 246..283
AAA_19 [PF13245], Evalue: 8.40E-08, Aligned region: 540..559
AAA_17 [PF13207], Evalue: 1.00E-07, Aligned region: 258..317
AAA_17 [PF13207], Evalue: 1.00E-07, Aligned region: 538..593
Zeta_toxin [PF06414], Evalue: 1.20E-07, Aligned region: 255..290
Zeta_toxin [PF06414], Evalue: 1.20E-07, Aligned region: 528..573
AAA_22 [PF13401], Evalue: 1.60E-07, Aligned region: 253..291
AAA_22 [PF13401], Evalue: 1.60E-07, Aligned region: 538..581
IstB_IS21 [PF01695], Evalue: 7.10E-07, Aligned region: 252..391
IstB_IS21 [PF01695], Evalue: 7.10E-07, Aligned region: 537..560
AAA_33 [PF13671], Evalue: 2.60E-06, Aligned region: 257..294
AAA_33 [PF13671], Evalue: 2.60E-06, Aligned region: 538..559
AAA_33 [PF13671], Evalue: 2.60E-06, Aligned region: 1057..1085
AAA_18 [PF13238], Evalue: 4.70E-05, Aligned region: 258..295
AAA_18 [PF13238], Evalue: 4.70E-05, Aligned region: 539..562
Arch_ATPase [PF01637], Evalue: 5.60E-05, Aligned region: 236..280
Arch_ATPase [PF01637], Evalue: 5.60E-05, Aligned region: 536..555
Arch_ATPase [PF01637], Evalue: 5.60E-05, Aligned region: 603..614
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 253..279
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 314..353
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 496..563
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 899..922
AAA_3 [PF07726], Evalue: 0.00026, Aligned region: 258..280
AAA_3 [PF07726], Evalue: 0.00026, Aligned region: 539..650
MobB [PF03205], Evalue: 0.0003, Aligned region: 257..282
MobB [PF03205], Evalue: 0.0003, Aligned region: 538..560
ABC_tran [PF00005], Evalue: 0.00031, Aligned region: 252..272
ABC_tran [PF00005], Evalue: 0.00031, Aligned region: 536..558
AAA_14 [PF13173], Evalue: 0.00052, Aligned region: 255..279
AAA_14 [PF13173], Evalue: 0.00052, Aligned region: 538..626
ResIII [PF04851], Evalue: 0.00065, Aligned region: 242..279
ResIII [PF04851], Evalue: 0.00065, Aligned region: 508..558
NACHT [PF05729], Evalue: 0.00069, Aligned region: 257..283
NACHT [PF05729], Evalue: 0.00069, Aligned region: 537..580
AAA_24 [PF13479], Evalue: 0.0013, Aligned region: 257..285
AAA_24 [PF13479], Evalue: 0.0013, Aligned region: 537..559
TrwB_AAD_bind [PF10412], Evalue: 0.0016, Aligned region: 251..285
TrwB_AAD_bind [PF10412], Evalue: 0.0016, Aligned region: 536..570
Mg_chelatase [PF01078], Evalue: 0.0022, Aligned region: 255..277
Mg_chelatase [PF01078], Evalue: 0.0022, Aligned region: 538..558
Mg_chelatase [PF01078], Evalue: 0.0022, Aligned region: 591..630
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 258..279
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 538..559
AAA_28 [PF13521], Evalue: 0.0027, Aligned region: 258..275
AAA_28 [PF13521], Evalue: 0.0027, Aligned region: 538..557
Sigma54_activat [PF00158], Evalue: 0.0032, Aligned region: 255..281
Sigma54_activat [PF00158], Evalue: 0.0032, Aligned region: 531..660
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 253..272
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 536..562
AAA_10 [PF12846], Evalue: 0.0043, Aligned region: 257..281
AAA_10 [PF12846], Evalue: 0.0043, Aligned region: 537..574
AAA_10 [PF12846], Evalue: 0.0043, Aligned region: 729..839
RuvB_N [PF05496], Evalue: 0.0045, Aligned region: 252..272
RuvB_N [PF05496], Evalue: 0.0045, Aligned region: 504..558
cobW [PF02492], Evalue: 0.0046, Aligned region: 256..279
cobW [PF02492], Evalue: 0.0046, Aligned region: 538..549
cobW [PF02492], Evalue: 0.0046, Aligned region: 928..970
Torsin [PF06309], Evalue: 0.0052, Aligned region: 494..560
DUF258 [PF03193], Evalue: 0.0067, Aligned region: 244..279
DUF258 [PF03193], Evalue: 0.0067, Aligned region: 535..555
SRP54 [PF00448], Evalue: 0.0069, Aligned region: 256..281
SRP54 [PF00448], Evalue: 0.0069, Aligned region: 536..558
AAA_30 [PF13604], Evalue: 0.0078, Aligned region: 244..279
AAA_30 [PF13604], Evalue: 0.0078, Aligned region: 538..558
Protein Sequence: 1127 a.a.     [Download]
>gi|108759056|ref|YP_632985.1| ClpA/B family protein [Myxococcus xanthus DK 1622]
MDLKLPFVVAPHSGRLVEAWVPAFFPALHKVGPSLSMLRDELALAVMERFERESPSQVAQYQLPPHFALK
RVTVDAEGRDREKNRRVVLQGTMSVLLEKWPRDTFWVVTPTRLPAARFALNQPADLPQALARRLMAWCLE
HNLDSLDTHWAQGREQLELLEVDAYAPSVLPRTPPRPAQPARRRRTKNPEKEDTAPETPEQREQRRNRRR
LTLVELRAVARNLSHGARDGTLERCFGREALVRELVEALEGREGSALVLVGPPGAGKTALIHEAVSRLTA
RQDAAGVRRDVWRVDGNQFIAGMMYVGQWEARARGVVKELMEVGDLLYVDDLASLVYAGRTRNERTNVAQ
FLEPHMARGELTVLAESTPERFERVREEAPTLASLFRVIHVPALDARATLPALLGTVRDLEAEGTDSAVQ
LSPLALETLLSLQERFVSHEAFPGKAVRLLRRVMARQGVSTSGTRRFSSGDVIDAMREQTGLPDFILGSA
QPKKREALTWEMQRQVAGQPEAVEAVVDAILTLQSALQPSDKPLATYLFVGPTGVGKTETAKALARTLFG
GEQRLIRFDMSEFVTSSSITRLLGRPGAPDGELTTALRTQPFCVVLFDEVEKAHPRVFDALLQFLGEGRL
TDGAGRTVDARQSVVVLTSNLGVREAATHTGFHRAADSADAHYLSAVRAWFRPEFFNRLDRVVPFRPLTP
AALRVVVDLALEALLSRHGIRQGNVLVEVEPRLLDLLVEEAYDPRYGARPLKRALEKRLTLPLAHHLVRR
SADDLARVELLRDGNDMRVSVEVLVNAPAWAPERPASAWSLTEVSRLLEETRSRLEALMTEGVPEAGELA
ERLHRLALEATDIRDYELVPRDFLDAESPASTVKQMLTSHSSHVGHLGLRQRPVYEERPLHVSNEEQLRR
AQPRVLALRDETAWVEHQLTHLARGTDVVTVLVEGLGDATPSAVWTVAHSLPSALGESAMYLEAVHADGR
TEWLRSGDERSEDLVLRRVAVRMSAIGLREVLAPLRGYALVDLVYGDGPRQVLVRLEHLSEDVGSLEDVP
RVMAAWDEAVVRERDARRSGAASVGAASHVILRGREGVTTGRPHDSTELTHVASGRRPREALAWAARVLR
EPSQGHD
 
Nucleotide Sequence: 3384 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6035918-6039301 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGACCTGAAGCTTCCCTTCGTGGTGGCCCCGCACAGCGGCCGGCTCGTCGAGGCCTGGGTGCCCGCCT
TCTTCCCGGCGCTGCACAAGGTGGGGCCCAGCCTCTCCATGCTGCGAGACGAACTCGCGCTCGCCGTCAT
GGAGCGCTTCGAGCGCGAATCGCCCTCCCAGGTGGCGCAGTACCAACTTCCACCCCACTTCGCCCTCAAG
CGCGTCACCGTCGATGCGGAAGGAAGGGACCGGGAGAAGAACCGGCGCGTCGTCCTCCAGGGCACCATGT
CCGTGCTGCTGGAGAAGTGGCCCCGTGACACCTTCTGGGTCGTCACCCCCACCCGGCTCCCCGCCGCGCG
CTTCGCGCTGAACCAGCCCGCGGACCTGCCCCAGGCGCTCGCGCGACGGCTGATGGCCTGGTGTCTGGAA
CACAACCTGGACTCCCTGGACACGCACTGGGCCCAGGGCCGGGAGCAACTGGAGCTCCTGGAGGTGGATG
CCTATGCCCCCTCCGTCCTCCCGCGCACGCCGCCGCGACCGGCCCAGCCCGCGCGACGCCGCCGGACCAA
GAATCCGGAGAAGGAAGACACCGCGCCCGAAACGCCAGAGCAGCGGGAGCAACGCCGCAACCGGCGGCGC
CTCACCCTGGTGGAGCTCCGGGCCGTGGCGCGCAACCTGAGCCACGGTGCGCGAGACGGCACGCTGGAAC
GTTGCTTCGGCCGGGAGGCGCTGGTTCGCGAGCTCGTAGAGGCGCTCGAAGGCCGCGAAGGCTCCGCGCT
GGTGCTGGTGGGTCCACCTGGCGCGGGCAAGACGGCCCTGATTCATGAAGCGGTGAGCCGGCTCACCGCC
CGGCAGGACGCCGCGGGCGTGCGTCGCGACGTGTGGCGCGTGGACGGCAACCAGTTCATCGCCGGGATGA
TGTACGTGGGCCAGTGGGAGGCCCGCGCGCGGGGCGTGGTGAAGGAGCTGATGGAGGTCGGCGACCTGCT
CTACGTGGACGACCTGGCCTCGCTCGTCTACGCGGGCCGCACGCGCAATGAGCGCACCAACGTCGCGCAG
TTCCTGGAGCCCCACATGGCCCGGGGCGAGCTCACCGTGCTCGCCGAGTCCACGCCCGAGCGCTTCGAGC
GCGTGCGGGAAGAAGCCCCCACCCTCGCCTCGCTCTTCCGGGTCATCCATGTCCCCGCGCTGGATGCGCG
TGCCACGCTGCCCGCGCTCCTCGGCACCGTGCGCGACCTGGAGGCGGAAGGCACGGACAGCGCGGTCCAG
CTCTCGCCGCTGGCGCTGGAGACCCTGCTCTCATTGCAGGAGCGCTTCGTGTCGCACGAGGCGTTCCCGG
GCAAGGCCGTCCGTCTGCTCCGCCGCGTCATGGCCCGACAGGGCGTCAGCACCTCGGGCACCCGGCGCTT
TTCGTCGGGGGACGTCATCGACGCGATGCGGGAGCAGACGGGCCTACCGGATTTCATCCTGGGAAGCGCC
CAGCCGAAGAAGCGCGAAGCGCTGACGTGGGAGATGCAGCGGCAGGTAGCGGGCCAGCCCGAAGCCGTGG
AAGCCGTGGTGGACGCCATCCTCACGTTGCAGTCCGCGCTCCAGCCGTCCGACAAGCCCCTGGCCACCTA
CCTCTTCGTGGGCCCCACGGGCGTGGGCAAGACGGAGACGGCGAAGGCGCTCGCGCGGACGCTCTTCGGC
GGAGAGCAGCGGCTCATCCGTTTCGACATGTCGGAGTTCGTCACGTCCTCCAGCATCACCCGGCTGCTCG
GGCGGCCCGGCGCGCCCGACGGTGAGCTGACCACCGCGCTGCGCACCCAGCCCTTCTGCGTGGTGCTGTT
TGACGAGGTGGAGAAGGCCCATCCCCGCGTGTTCGACGCCCTCCTCCAGTTCCTTGGTGAGGGACGGCTG
ACGGACGGAGCGGGACGCACGGTGGATGCCCGGCAGTCCGTCGTCGTGCTCACGAGCAACCTCGGCGTGC
GCGAGGCCGCCACCCACACCGGTTTCCACCGCGCCGCGGACAGCGCGGATGCGCACTACCTCTCCGCCGT
GCGTGCCTGGTTCCGCCCGGAGTTCTTCAACCGCCTGGACCGGGTGGTGCCCTTCCGTCCGCTCACGCCC
GCCGCGCTGCGCGTGGTGGTGGACCTCGCGCTCGAAGCCCTGCTGTCGCGCCATGGCATCCGGCAGGGCA
ACGTGCTGGTGGAGGTCGAGCCGCGCCTGCTGGACCTGCTGGTGGAGGAGGCCTACGACCCGCGCTACGG
AGCCCGCCCCCTCAAGCGCGCACTGGAGAAGCGCCTCACGTTGCCCCTGGCCCACCACCTGGTGCGGCGG
AGCGCGGACGACCTGGCGCGCGTGGAGCTGCTACGGGACGGCAACGACATGCGCGTGTCGGTGGAGGTGC
TGGTCAACGCGCCCGCGTGGGCGCCCGAGCGGCCGGCCTCTGCGTGGAGCCTGACCGAGGTTTCCCGCCT
GCTCGAGGAGACCCGCTCGCGGCTGGAGGCGTTGATGACGGAGGGGGTGCCCGAGGCGGGAGAACTGGCG
GAGCGACTGCACCGGCTGGCACTCGAGGCCACGGACATTCGCGACTACGAGTTGGTCCCGCGCGACTTCC
TGGACGCGGAGTCGCCTGCGTCCACCGTGAAGCAGATGCTGACGTCGCACTCGAGTCACGTGGGCCACCT
GGGCCTGCGGCAGCGCCCTGTGTATGAGGAGCGCCCACTGCACGTCTCGAACGAAGAACAGCTCCGCCGC
GCACAGCCCCGGGTGTTGGCCCTTCGCGACGAGACCGCCTGGGTCGAACATCAGCTCACGCACCTGGCGA
GGGGGACGGACGTCGTGACGGTGTTGGTGGAGGGGCTCGGCGACGCGACGCCATCCGCGGTGTGGACCGT
GGCCCACTCCCTCCCCAGCGCGCTCGGGGAGTCGGCGATGTACCTGGAAGCCGTCCATGCCGACGGGCGC
ACCGAGTGGCTCCGGTCCGGAGACGAGCGGTCCGAGGACCTGGTGCTTCGGCGTGTCGCCGTGCGGATGT
CGGCCATCGGCCTGCGCGAGGTGCTGGCGCCCCTTCGAGGCTATGCGCTGGTGGACCTCGTCTATGGCGA
TGGGCCACGCCAGGTCCTGGTCCGGCTGGAGCACCTGTCCGAAGACGTCGGGAGTCTGGAAGACGTGCCG
CGCGTGATGGCCGCATGGGATGAGGCAGTCGTCCGCGAACGCGATGCCCGGAGGAGCGGCGCCGCGTCAG
TGGGCGCGGCCAGCCACGTCATCCTGCGTGGCCGCGAAGGTGTCACGACTGGGCGGCCCCACGACTCGAC
CGAACTCACGCACGTCGCGAGCGGACGCCGCCCCCGGGAGGCGCTCGCATGGGCCGCGAGGGTGCTCCGG
GAACCCAGCCAGGGACACGACTGA
 Primer design

Protein ID: 108759726
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4825
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6039087..6041597 [+]
ProductClpA/B family protein
NoteTssH
UniProt IDQ1D2Y7
KEGG IDmxa:MXAN_4825
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.70E-35, Aligned region: 303..374
AAA_2 [PF07724], Evalue: 5.70E-35, Aligned region: 395..411
AAA_2 [PF07724], Evalue: 5.70E-35, Aligned region: 573..733
AAA [PF00004], Evalue: 2.20E-16, Aligned region: 306..411
AAA [PF00004], Evalue: 2.20E-16, Aligned region: 579..654
ClpB_D2-small [PF10431], Evalue: 6.30E-16, Aligned region: 740..815
AAA_16 [PF13191], Evalue: 3.50E-13, Aligned region: 286..479
AAA_16 [PF13191], Evalue: 3.50E-13, Aligned region: 564..606
AAA_16 [PF13191], Evalue: 3.50E-13, Aligned region: 640..666
AAA_16 [PF13191], Evalue: 3.50E-13, Aligned region: 733..759
AAA_5 [PF07728], Evalue: 1.80E-08, Aligned region: 305..327
AAA_5 [PF07728], Evalue: 1.80E-08, Aligned region: 578..691
Sigma54_activat [PF00158], Evalue: 5.10E-06, Aligned region: 296..328
Sigma54_activat [PF00158], Evalue: 5.10E-06, Aligned region: 578..674
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 302..329
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 577..599
IstB_IS21 [PF01695], Evalue: 7.90E-05, Aligned region: 291..327
IstB_IS21 [PF01695], Evalue: 7.90E-05, Aligned region: 578..597
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 286..329
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 579..590
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 305..413
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 576..639
Hpr_kinase_C [PF07475], Evalue: 0.0012, Aligned region: 306..327
Hpr_kinase_C [PF07475], Evalue: 0.0012, Aligned region: 579..596
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 306..355
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 581..602
AAA_28 [PF13521], Evalue: 0.0037, Aligned region: 306..333
AAA_28 [PF13521], Evalue: 0.0037, Aligned region: 418..438
AAA_28 [PF13521], Evalue: 0.0037, Aligned region: 578..604
DUF258 [PF03193], Evalue: 0.0049, Aligned region: 291..331
DUF258 [PF03193], Evalue: 0.0049, Aligned region: 579..589
AAA_14 [PF13173], Evalue: 0.007, Aligned region: 305..326
AAA_14 [PF13173], Evalue: 0.007, Aligned region: 578..655
NACHT [PF05729], Evalue: 0.0073, Aligned region: 306..452
NACHT [PF05729], Evalue: 0.0073, Aligned region: 579..591
Protein Sequence: 836 a.a.     [Download]
>gi|108759726|ref|YP_632986.1| ClpA/B family protein [Myxococcus xanthus DK 1622]
MRQSSANAMPGGAAPRQWARPATSSCVAAKVSRLGGPTTRPNSRTSRADAAPGRRSHGPRGCSGNPARDT
TDMEKNVHLFVRTYPGLGVAAHVLTHPHLAAFAPTLHAARLDIAAVVGRLLKRGELWDEETHWSDLRQRK
TTLTVRALEHGKMLSVPLRLTVLTHGVKARTARKGAPARQSLRVWVPRVDVKGTLHDAADLEPFVEEMVR
HELYLASLDRLHSLAYVGEEQVETLSVPVRFRDTPRARALDAAKPQRRQAPPPGLAEASRCLNEEARAGL
LERAWERDLEVSRLAEAVTSRTRASVLLVGPSSVGKTALVHELVQRAEAATTGSPLHGLEVFSSSGGRIM
AGMRYLGQWQERVKHMVEALRVRQAVLHLDSLSELLSLGSGDTGLDVARQLLPALESGEVSLVLEATPED
VARAERTHAAFLQSLRHIAVAPLSAQAARNALQQASHRVGRARKVRFTPDALDRAGELTERFGSGPSPGG
AVSLLRAASTEPGAAGEVNAASVTRAFCTRTGYPLELVDSAIRLDPDALLRRFRERVVGQDEATLLLRNL
VVTLKTGLADPSRPLGAFLLLGPTGVGKTESALALAEYLFGDVARLARFDMAEYAAPGSATRLVGEAGGQ
QGSLARRVREQPFGVVLLDEIEKADAGVHDLLLQVLGEGRLTDATGRTVSFRNTVVLLTSNLGADSAGRS
LGFGERGPLERAAHYLGAAAAFFRPELLNRLDRVVPYRALTEDVIQSLARRTLEAALSREGLSRRGVKVT
FDEDVVKHLARTGFDARYGARPLKRAVEQQVVAPLARWLAAQATSAPPQVVLRVEAEGRIALSGLE
 
Nucleotide Sequence: 2511 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6039087-6041597 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGAGGCAGTCGTCCGCGAACGCGATGCCCGGAGGAGCGGCGCCGCGTCAGTGGGCGCGGCCAGCCACGT
CATCCTGCGTGGCCGCGAAGGTGTCACGACTGGGCGGCCCCACGACTCGACCGAACTCACGCACGTCGCG
AGCGGACGCCGCCCCCGGGAGGCGCTCGCATGGGCCGCGAGGGTGCTCCGGGAACCCAGCCAGGGACACG
ACTGACATGGAAAAGAACGTCCACCTCTTCGTGCGCACCTATCCCGGGCTGGGCGTGGCGGCGCACGTCC
TCACCCACCCGCACCTGGCGGCCTTCGCGCCGACGCTGCACGCCGCGAGGCTCGACATCGCTGCGGTGGT
GGGGCGGCTCCTCAAGCGAGGAGAGCTCTGGGACGAGGAGACCCACTGGAGCGATTTGCGCCAGCGGAAG
ACGACGCTGACGGTGCGCGCGCTCGAACACGGGAAGATGCTGTCCGTCCCCCTGCGCCTCACCGTGCTCA
CGCACGGGGTGAAGGCCCGCACCGCACGCAAGGGAGCACCAGCGCGCCAGTCCCTACGCGTGTGGGTGCC
CCGCGTGGACGTCAAGGGCACGCTGCACGATGCGGCGGACCTGGAGCCCTTCGTCGAGGAGATGGTCCGC
CACGAGCTCTATCTCGCGTCGCTCGACCGGCTGCACTCTCTGGCCTACGTGGGCGAGGAGCAGGTAGAGA
CGCTGTCGGTGCCGGTCCGCTTCCGGGACACGCCGCGTGCCCGTGCGCTCGATGCCGCGAAGCCGCAGCG
GCGCCAGGCGCCACCACCGGGGCTCGCGGAAGCCAGCCGGTGTCTCAATGAGGAAGCACGCGCGGGTTTG
CTGGAGCGCGCCTGGGAACGGGACCTGGAGGTGTCCCGGCTCGCGGAGGCCGTCACCTCGCGCACCCGTG
CCAGCGTGCTCCTGGTAGGCCCGTCGTCCGTGGGCAAGACGGCCCTGGTTCATGAACTCGTGCAACGCGC
GGAGGCGGCCACCACGGGTTCGCCGCTTCACGGGTTGGAGGTCTTCAGCTCCTCCGGAGGCCGCATCATG
GCGGGCATGCGCTACCTGGGGCAGTGGCAGGAGCGCGTGAAGCACATGGTGGAGGCCCTGCGTGTTCGCC
AGGCCGTGCTGCACCTCGACAGCCTGTCGGAGCTGCTGTCCCTGGGTAGCGGCGACACGGGGCTGGATGT
GGCGCGTCAGTTGCTCCCCGCATTGGAAAGTGGCGAGGTCTCACTCGTCCTGGAGGCAACACCGGAGGAC
GTGGCCCGCGCGGAGCGGACCCACGCAGCGTTCCTGCAATCGCTCCGGCACATCGCCGTGGCGCCCCTTT
CGGCCCAGGCCGCACGCAACGCGCTTCAGCAGGCCTCGCATCGGGTGGGCCGCGCTCGCAAGGTGCGCTT
CACGCCCGACGCGCTGGACCGCGCTGGCGAACTCACGGAGCGCTTCGGCTCGGGCCCTTCGCCCGGAGGC
GCGGTGTCCCTGCTGCGCGCCGCCAGCACGGAGCCCGGCGCGGCCGGAGAAGTGAACGCCGCTTCGGTGA
CGCGCGCCTTCTGCACTCGGACGGGGTACCCGCTCGAACTGGTGGACTCCGCCATCCGGTTGGACCCGGA
TGCCCTGCTCCGCCGCTTCCGCGAGCGCGTGGTGGGCCAGGACGAGGCCACCCTCCTCCTGCGCAATCTG
GTCGTCACGCTGAAAACAGGCCTGGCGGACCCCTCGCGTCCGCTGGGCGCCTTCCTGCTGCTGGGTCCCA
CCGGCGTGGGCAAGACGGAGTCGGCGCTCGCGCTGGCGGAGTACCTGTTTGGCGACGTGGCCCGGCTGGC
GCGCTTCGACATGGCGGAGTACGCCGCGCCAGGCAGCGCCACCCGGCTGGTGGGAGAAGCGGGAGGCCAA
CAAGGCAGCCTGGCGCGGCGCGTCCGCGAGCAGCCCTTCGGCGTGGTGCTGCTGGACGAAATCGAGAAAG
CGGACGCGGGCGTCCATGACCTGCTGTTGCAGGTGCTCGGCGAAGGCCGGCTCACGGATGCCACCGGCCG
CACCGTCAGCTTCCGCAACACCGTGGTGCTGCTCACCAGCAACCTGGGCGCGGACAGCGCGGGGCGCTCG
CTGGGTTTCGGGGAGCGCGGCCCCCTGGAGCGGGCGGCGCACTACCTGGGGGCCGCGGCGGCCTTCTTCC
GGCCGGAGTTGCTGAACCGGTTGGACCGGGTGGTGCCCTACCGCGCGCTCACGGAGGACGTCATTCAATC
ACTCGCCCGGCGCACGTTGGAGGCGGCCCTCTCTCGCGAGGGGCTCAGTCGCCGGGGCGTGAAGGTGACC
TTCGACGAGGACGTGGTGAAGCACCTGGCGCGCACCGGCTTCGACGCACGCTATGGGGCCAGGCCTCTCA
AGCGCGCCGTGGAGCAACAGGTGGTCGCGCCCCTGGCGCGGTGGTTGGCGGCTCAGGCCACCAGCGCTCC
GCCCCAGGTGGTGCTCCGCGTGGAAGCTGAGGGGCGGATTGCGTTGAGCGGCCTCGAATGA
 Primer design

Protein ID: 108761289
SecReT6 ID127
T6SS typei1
Gene symbolclpC
Locus tagMXAN_4832
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6046572..6049226 [-]
ProductATP-dependent Clp protease, ATP-binding subunit ClpC
NoteTssH
UniProt IDQ1D2Y0
KEGG IDmxa:MXAN_4832
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-57, Aligned region: 272..355
AAA_2 [PF07724], Evalue: 1.90E-57, Aligned region: 605..769
AAA [PF00004], Evalue: 1.70E-27, Aligned region: 273..404
AAA [PF00004], Evalue: 1.70E-27, Aligned region: 611..735
ClpB_D2-small [PF10431], Evalue: 2.90E-24, Aligned region: 776..855
Clp_N [PF02861], Evalue: 9.30E-24, Aligned region: 94..143
Clp_N [PF02861], Evalue: 9.30E-24, Aligned region: 166..217
Clp_N [PF02861], Evalue: 9.30E-24, Aligned region: 792..814
AAA_5 [PF07728], Evalue: 1.10E-19, Aligned region: 273..352
AAA_5 [PF07728], Evalue: 1.10E-19, Aligned region: 398..491
AAA_5 [PF07728], Evalue: 1.10E-19, Aligned region: 610..731
AAA_5 [PF07728], Evalue: 1.10E-19, Aligned region: 863..877
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 250..295
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 311..351
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 386..470
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 582..646
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 676..705
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 270..353
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 608..704
Sigma54_activat [PF00158], Evalue: 5.00E-10, Aligned region: 254..296
Sigma54_activat [PF00158], Evalue: 5.00E-10, Aligned region: 603..739
Arch_ATPase [PF01637], Evalue: 1.80E-08, Aligned region: 251..421
Arch_ATPase [PF01637], Evalue: 1.80E-08, Aligned region: 611..633
Arch_ATPase [PF01637], Evalue: 1.80E-08, Aligned region: 677..692
AAA_18 [PF13238], Evalue: 8.90E-08, Aligned region: 274..397
AAA_18 [PF13238], Evalue: 8.90E-08, Aligned region: 612..635
AAA_14 [PF13173], Evalue: 2.00E-07, Aligned region: 273..355
AAA_14 [PF13173], Evalue: 2.00E-07, Aligned region: 612..707
RuvB_N [PF05496], Evalue: 3.20E-06, Aligned region: 272..293
RuvB_N [PF05496], Evalue: 3.20E-06, Aligned region: 340..353
RuvB_N [PF05496], Evalue: 3.20E-06, Aligned region: 561..630
RuvB_N [PF05496], Evalue: 3.20E-06, Aligned region: 680..708
AAA_17 [PF13207], Evalue: 4.20E-06, Aligned region: 274..338
AAA_17 [PF13207], Evalue: 4.20E-06, Aligned region: 614..654
IstB_IS21 [PF01695], Evalue: 6.50E-06, Aligned region: 268..296
IstB_IS21 [PF01695], Evalue: 6.50E-06, Aligned region: 610..629
Mg_chelatase [PF01078], Evalue: 6.30E-05, Aligned region: 269..290
Mg_chelatase [PF01078], Evalue: 6.30E-05, Aligned region: 609..632
AAA_19 [PF13245], Evalue: 0.00016, Aligned region: 270..297
AAA_19 [PF13245], Evalue: 0.00016, Aligned region: 612..631
NACHT [PF05729], Evalue: 0.00029, Aligned region: 273..296
NACHT [PF05729], Evalue: 0.00029, Aligned region: 612..636
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 272..293
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 387..419
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 602..663
MMR_HSR1 [PF01926], Evalue: 0.00037, Aligned region: 273..348
MMR_HSR1 [PF01926], Evalue: 0.00037, Aligned region: 611..634
AAA_3 [PF07726], Evalue: 0.00072, Aligned region: 274..293
AAA_3 [PF07726], Evalue: 0.00072, Aligned region: 615..728
RNA_helicase [PF00910], Evalue: 0.00075, Aligned region: 274..296
RNA_helicase [PF00910], Evalue: 0.00075, Aligned region: 611..632
AAA_28 [PF13521], Evalue: 0.0013, Aligned region: 273..305
AAA_28 [PF13521], Evalue: 0.0013, Aligned region: 610..630
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 273..290
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 500..574
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 608..734
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 254..292
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 610..629
AAA_29 [PF13555], Evalue: 0.0022, Aligned region: 268..290
AAA_29 [PF13555], Evalue: 0.0022, Aligned region: 608..636
NTPase_1 [PF03266], Evalue: 0.0045, Aligned region: 274..295
NTPase_1 [PF03266], Evalue: 0.0045, Aligned region: 324..350
NTPase_1 [PF03266], Evalue: 0.0045, Aligned region: 614..633
AAA_24 [PF13479], Evalue: 0.0052, Aligned region: 273..288
AAA_24 [PF13479], Evalue: 0.0052, Aligned region: 610..641
ResIII [PF04851], Evalue: 0.0053, Aligned region: 257..295
ResIII [PF04851], Evalue: 0.0053, Aligned region: 333..354
ResIII [PF04851], Evalue: 0.0053, Aligned region: 582..630
ABC_tran [PF00005], Evalue: 0.0074, Aligned region: 273..293
ABC_tran [PF00005], Evalue: 0.0074, Aligned region: 612..633
AAA_25 [PF13481], Evalue: 0.0076, Aligned region: 273..310
AAA_25 [PF13481], Evalue: 0.0076, Aligned region: 590..628
Protein Sequence: 884 a.a.     [Download]
>gi|108761289|ref|YP_632993.1| ATP-dependent Clp protease, ATP-binding subunit ClpC [Myxococcus xanthus DK 1622]
MANVCDLCHQRPATTRVTRVMGNRRTTESLCDVCSSQRSRFGRMGLGTSLFDQFFSDFGDEDFGGLSRSL
QQPVERYDITEAFSDETRRVLEAAFEAARSAGAASIDTEHLLVALAKDPLGRTALSRMKLDPARVAERAE
SEMRRGKRPMERPELSPHAKRALELAYQEAYELGHSYVGPEHVLLGLLHEGEGLASEILREQGAQHGKAR
AAVAEALAPSSEARRSPTPTLDEYCRDLTSLASEGKLDPVVGRANEIETTLEILSRRTKNNPVLIGEPGV
GKTAIVEGIAQRIISAAVPDTLRDKRVLQLDLSGLLAGSKYRGEFEERLKKVMDEVKSHSEDIVLFIDEI
HTIVGAGAAEGAMDAGNMLKPSLARGELHVIGATTLDEYRKRIEKDAALERRFQPVVVPEPTAEQAIEIL
RGLKDRYESHHRVRIADEALVAAVELSDRYVTGRFLPDKAIDLVDQAAARVRLRLTLPPERLVNAEHEVV
KVKRSLDEARGRKAGPRIQELESKLNAAEREVQSAQKERRTQKSGETPEVRAEDVAEVLSRMTGIPVTQM
TEDERKKLLELESRLHERVIGQDEAIRVLSQAIRRARAGLKDESRPIGSFLFLGPTGVGKTELAKTLAEL
LFGDEKALIRFDMSEYMEKHTVSRLVGAPPGYVGYEEGGQLTEAVRRRPYSVLLFDEVEKAHPDVFHMLL
QVLDDGRLTDAQGTVVNFKNTVIIGTSNLGSHLIQESTARKEPQERMRERVMGVLKGHFPPEFLNRIDET
VVFEPLNRAQLRAIVDLMLEKTRRLLHGQGIDLEVTPAALEALVDKGWDPTFGARPLRREIQRAIEAPLA
EKLISGDIHENSRVRADFKDGKFRFDEVEAAEAEVAQAEASAVH
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|108756767|ref|NC_008095.1|:c6049226-6046572 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGCCAATGTCTGCGACCTCTGCCACCAGCGCCCGGCGACCACCCGAGTCACCCGCGTCATGGGGAACC
GGCGGACCACCGAGTCCCTGTGTGACGTCTGTAGCAGCCAGCGCTCGCGCTTCGGCCGCATGGGCCTGGG
CACGTCGCTCTTCGACCAGTTCTTCAGTGACTTCGGAGACGAGGACTTCGGGGGGCTGTCGCGTTCACTC
CAGCAGCCGGTGGAGCGCTACGACATCACCGAGGCCTTCTCCGATGAGACGCGGCGCGTATTGGAAGCGG
CCTTCGAGGCGGCGCGAAGCGCGGGGGCGGCTTCCATCGACACGGAGCACCTGCTGGTGGCGCTCGCGAA
GGACCCGCTGGGCCGGACCGCGCTCAGCCGCATGAAGCTGGACCCGGCCCGCGTCGCCGAGCGCGCCGAG
TCCGAGATGCGCCGTGGGAAGCGCCCCATGGAGCGTCCCGAGCTGTCGCCGCATGCGAAGCGCGCCCTGG
AACTCGCGTACCAGGAGGCCTACGAGCTGGGACATTCCTATGTGGGGCCCGAACACGTGCTGCTGGGGTT
GCTGCACGAAGGGGAAGGCCTGGCGTCGGAGATTCTGCGCGAGCAAGGGGCCCAGCACGGCAAGGCGCGC
GCGGCCGTCGCGGAAGCGCTGGCACCTTCATCCGAGGCACGCCGGTCGCCCACGCCCACGCTGGACGAGT
ACTGCCGCGACCTGACGAGCCTGGCCTCGGAAGGGAAGCTGGACCCGGTGGTGGGGCGGGCCAACGAAAT
CGAGACCACGCTCGAAATCCTCTCGCGTCGTACGAAGAACAACCCCGTGCTCATTGGTGAGCCGGGCGTG
GGCAAGACGGCCATCGTGGAGGGCATTGCCCAGCGCATCATCTCCGCCGCGGTCCCGGACACGCTGCGCG
ACAAACGCGTGCTGCAACTGGACCTGTCCGGCCTGCTCGCGGGCAGCAAGTACCGCGGTGAGTTCGAGGA
GCGGCTGAAGAAGGTCATGGACGAGGTGAAGTCGCACAGCGAGGACATCGTCCTCTTCATCGACGAGATT
CACACCATCGTCGGGGCGGGCGCGGCGGAGGGGGCCATGGATGCGGGCAACATGCTCAAGCCATCCCTGG
CGCGCGGCGAGCTGCACGTCATCGGCGCGACGACGTTGGATGAATACCGCAAGCGCATCGAGAAGGATGC
TGCGCTCGAACGCCGCTTCCAGCCCGTGGTCGTCCCGGAGCCGACGGCCGAGCAGGCCATTGAGATTCTG
CGAGGCCTCAAGGACCGCTACGAGTCCCACCACCGCGTGCGCATCGCGGACGAGGCGCTGGTGGCGGCGG
TGGAGCTGTCGGACCGTTACGTCACAGGGCGCTTCCTGCCGGACAAGGCCATCGACCTGGTGGACCAGGC
GGCGGCCCGCGTGCGCTTGCGGCTCACGCTGCCACCGGAGCGACTGGTGAATGCCGAGCATGAGGTGGTG
AAGGTGAAGCGCTCGCTCGACGAGGCTCGCGGCCGGAAGGCGGGGCCGCGCATCCAGGAGCTGGAGTCGA
AGCTGAACGCCGCCGAGCGCGAGGTCCAGAGCGCGCAGAAGGAGCGCCGCACGCAGAAGTCCGGTGAGAC
GCCGGAGGTCCGCGCCGAGGACGTGGCGGAGGTGCTGTCGCGCATGACGGGCATCCCCGTGACGCAGATG
ACGGAGGACGAGCGCAAGAAGCTGCTGGAGCTGGAGTCGCGGCTGCACGAGCGCGTCATCGGTCAGGACG
AGGCCATCCGCGTGTTGTCCCAGGCCATCCGGCGGGCGAGGGCGGGGCTCAAGGACGAGTCGCGCCCCAT
CGGCTCCTTCCTCTTCCTGGGCCCCACGGGCGTGGGCAAGACGGAGTTGGCGAAGACGCTGGCGGAGCTG
CTCTTCGGTGACGAGAAGGCGCTCATCCGCTTCGACATGAGTGAGTACATGGAGAAGCACACCGTGAGCC
GGCTGGTGGGCGCGCCGCCGGGCTATGTCGGCTACGAGGAGGGCGGGCAGCTCACCGAGGCCGTGCGGCG
GCGGCCCTACTCCGTGCTCCTCTTCGACGAGGTGGAGAAGGCCCACCCCGACGTGTTCCACATGCTGCTC
CAGGTGCTGGATGACGGGCGGCTCACGGACGCGCAGGGCACGGTGGTGAACTTCAAGAACACCGTCATCA
TCGGCACCAGCAACCTGGGCTCGCACCTCATCCAGGAGTCCACCGCGCGCAAGGAACCGCAGGAGCGCAT
GCGGGAGCGCGTCATGGGCGTGCTCAAGGGGCACTTCCCGCCCGAGTTCCTCAACCGCATCGACGAGACG
GTGGTCTTCGAGCCGCTCAACCGCGCGCAGCTGCGCGCCATCGTGGACCTGATGCTGGAGAAGACGCGCC
GCCTGCTGCACGGCCAGGGCATTGACCTGGAGGTGACGCCCGCGGCGCTGGAAGCGCTGGTGGACAAGGG
ATGGGACCCAACCTTCGGCGCGCGTCCGCTGCGGCGTGAAATCCAGCGCGCCATCGAGGCGCCACTCGCG
GAGAAGCTCATCTCGGGCGACATCCATGAGAACAGCCGCGTGAGAGCGGACTTCAAGGACGGAAAATTCC
GGTTCGACGAAGTGGAGGCCGCTGAGGCGGAAGTCGCGCAGGCTGAAGCGAGTGCCGTTCACTGA
 Primer design