SecReT6
Protein ID: 108759056
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4824
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6035918..6039301 [+]
ProductClpA/B family protein
NoteTssH
UniProt IDQ1D2Y8
KEGG IDmxa:MXAN_4824
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.90E-34, Aligned region: 256..289
AAA_2 [PF07724], Evalue: 9.90E-34, Aligned region: 533..691
AAA [PF00004], Evalue: 1.10E-17, Aligned region: 258..352
AAA [PF00004], Evalue: 1.10E-17, Aligned region: 538..629
AAA_5 [PF07728], Evalue: 2.60E-15, Aligned region: 257..331
AAA_5 [PF07728], Evalue: 2.60E-15, Aligned region: 538..649
ClpB_D2-small [PF10431], Evalue: 9.10E-15, Aligned region: 698..777
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 187..222
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 234..344
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 522..573
AAA_19 [PF13245], Evalue: 8.40E-08, Aligned region: 246..283
AAA_19 [PF13245], Evalue: 8.40E-08, Aligned region: 540..559
AAA_17 [PF13207], Evalue: 1.00E-07, Aligned region: 258..317
AAA_17 [PF13207], Evalue: 1.00E-07, Aligned region: 538..593
Zeta_toxin [PF06414], Evalue: 1.20E-07, Aligned region: 255..290
Zeta_toxin [PF06414], Evalue: 1.20E-07, Aligned region: 528..573
AAA_22 [PF13401], Evalue: 1.60E-07, Aligned region: 253..291
AAA_22 [PF13401], Evalue: 1.60E-07, Aligned region: 538..581
IstB_IS21 [PF01695], Evalue: 7.10E-07, Aligned region: 252..391
IstB_IS21 [PF01695], Evalue: 7.10E-07, Aligned region: 537..560
AAA_33 [PF13671], Evalue: 2.60E-06, Aligned region: 257..294
AAA_33 [PF13671], Evalue: 2.60E-06, Aligned region: 538..559
AAA_33 [PF13671], Evalue: 2.60E-06, Aligned region: 1057..1085
AAA_18 [PF13238], Evalue: 4.70E-05, Aligned region: 258..295
AAA_18 [PF13238], Evalue: 4.70E-05, Aligned region: 539..562
Arch_ATPase [PF01637], Evalue: 5.60E-05, Aligned region: 236..280
Arch_ATPase [PF01637], Evalue: 5.60E-05, Aligned region: 536..555
Arch_ATPase [PF01637], Evalue: 5.60E-05, Aligned region: 603..614
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 253..279
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 314..353
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 496..563
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 899..922
AAA_3 [PF07726], Evalue: 0.00026, Aligned region: 258..280
AAA_3 [PF07726], Evalue: 0.00026, Aligned region: 539..650
MobB [PF03205], Evalue: 0.0003, Aligned region: 257..282
MobB [PF03205], Evalue: 0.0003, Aligned region: 538..560
ABC_tran [PF00005], Evalue: 0.00031, Aligned region: 252..272
ABC_tran [PF00005], Evalue: 0.00031, Aligned region: 536..558
AAA_14 [PF13173], Evalue: 0.00052, Aligned region: 255..279
AAA_14 [PF13173], Evalue: 0.00052, Aligned region: 538..626
ResIII [PF04851], Evalue: 0.00065, Aligned region: 242..279
ResIII [PF04851], Evalue: 0.00065, Aligned region: 508..558
NACHT [PF05729], Evalue: 0.00069, Aligned region: 257..283
NACHT [PF05729], Evalue: 0.00069, Aligned region: 537..580
AAA_24 [PF13479], Evalue: 0.0013, Aligned region: 257..285
AAA_24 [PF13479], Evalue: 0.0013, Aligned region: 537..559
TrwB_AAD_bind [PF10412], Evalue: 0.0016, Aligned region: 251..285
TrwB_AAD_bind [PF10412], Evalue: 0.0016, Aligned region: 536..570
Mg_chelatase [PF01078], Evalue: 0.0022, Aligned region: 255..277
Mg_chelatase [PF01078], Evalue: 0.0022, Aligned region: 538..558
Mg_chelatase [PF01078], Evalue: 0.0022, Aligned region: 591..630
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 258..279
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 538..559
AAA_28 [PF13521], Evalue: 0.0027, Aligned region: 258..275
AAA_28 [PF13521], Evalue: 0.0027, Aligned region: 538..557
Sigma54_activat [PF00158], Evalue: 0.0032, Aligned region: 255..281
Sigma54_activat [PF00158], Evalue: 0.0032, Aligned region: 531..660
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 253..272
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 536..562
AAA_10 [PF12846], Evalue: 0.0043, Aligned region: 257..281
AAA_10 [PF12846], Evalue: 0.0043, Aligned region: 537..574
AAA_10 [PF12846], Evalue: 0.0043, Aligned region: 729..839
RuvB_N [PF05496], Evalue: 0.0045, Aligned region: 252..272
RuvB_N [PF05496], Evalue: 0.0045, Aligned region: 504..558
cobW [PF02492], Evalue: 0.0046, Aligned region: 256..279
cobW [PF02492], Evalue: 0.0046, Aligned region: 538..549
cobW [PF02492], Evalue: 0.0046, Aligned region: 928..970
Torsin [PF06309], Evalue: 0.0052, Aligned region: 494..560
DUF258 [PF03193], Evalue: 0.0067, Aligned region: 244..279
DUF258 [PF03193], Evalue: 0.0067, Aligned region: 535..555
SRP54 [PF00448], Evalue: 0.0069, Aligned region: 256..281
SRP54 [PF00448], Evalue: 0.0069, Aligned region: 536..558
AAA_30 [PF13604], Evalue: 0.0078, Aligned region: 244..279
AAA_30 [PF13604], Evalue: 0.0078, Aligned region: 538..558
Protein Sequence: 1127 a.a.     [Download]
>gi|108759056|ref|YP_632985.1| ClpA/B family protein [Myxococcus xanthus DK 1622]
MDLKLPFVVAPHSGRLVEAWVPAFFPALHKVGPSLSMLRDELALAVMERFERESPSQVAQYQLPPHFALK
RVTVDAEGRDREKNRRVVLQGTMSVLLEKWPRDTFWVVTPTRLPAARFALNQPADLPQALARRLMAWCLE
HNLDSLDTHWAQGREQLELLEVDAYAPSVLPRTPPRPAQPARRRRTKNPEKEDTAPETPEQREQRRNRRR
LTLVELRAVARNLSHGARDGTLERCFGREALVRELVEALEGREGSALVLVGPPGAGKTALIHEAVSRLTA
RQDAAGVRRDVWRVDGNQFIAGMMYVGQWEARARGVVKELMEVGDLLYVDDLASLVYAGRTRNERTNVAQ
FLEPHMARGELTVLAESTPERFERVREEAPTLASLFRVIHVPALDARATLPALLGTVRDLEAEGTDSAVQ
LSPLALETLLSLQERFVSHEAFPGKAVRLLRRVMARQGVSTSGTRRFSSGDVIDAMREQTGLPDFILGSA
QPKKREALTWEMQRQVAGQPEAVEAVVDAILTLQSALQPSDKPLATYLFVGPTGVGKTETAKALARTLFG
GEQRLIRFDMSEFVTSSSITRLLGRPGAPDGELTTALRTQPFCVVLFDEVEKAHPRVFDALLQFLGEGRL
TDGAGRTVDARQSVVVLTSNLGVREAATHTGFHRAADSADAHYLSAVRAWFRPEFFNRLDRVVPFRPLTP
AALRVVVDLALEALLSRHGIRQGNVLVEVEPRLLDLLVEEAYDPRYGARPLKRALEKRLTLPLAHHLVRR
SADDLARVELLRDGNDMRVSVEVLVNAPAWAPERPASAWSLTEVSRLLEETRSRLEALMTEGVPEAGELA
ERLHRLALEATDIRDYELVPRDFLDAESPASTVKQMLTSHSSHVGHLGLRQRPVYEERPLHVSNEEQLRR
AQPRVLALRDETAWVEHQLTHLARGTDVVTVLVEGLGDATPSAVWTVAHSLPSALGESAMYLEAVHADGR
TEWLRSGDERSEDLVLRRVAVRMSAIGLREVLAPLRGYALVDLVYGDGPRQVLVRLEHLSEDVGSLEDVP
RVMAAWDEAVVRERDARRSGAASVGAASHVILRGREGVTTGRPHDSTELTHVASGRRPREALAWAARVLR
EPSQGHD
 
Nucleotide Sequence: 3384 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6035918-6039301 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGACCTGAAGCTTCCCTTCGTGGTGGCCCCGCACAGCGGCCGGCTCGTCGAGGCCTGGGTGCCCGCCT
TCTTCCCGGCGCTGCACAAGGTGGGGCCCAGCCTCTCCATGCTGCGAGACGAACTCGCGCTCGCCGTCAT
GGAGCGCTTCGAGCGCGAATCGCCCTCCCAGGTGGCGCAGTACCAACTTCCACCCCACTTCGCCCTCAAG
CGCGTCACCGTCGATGCGGAAGGAAGGGACCGGGAGAAGAACCGGCGCGTCGTCCTCCAGGGCACCATGT
CCGTGCTGCTGGAGAAGTGGCCCCGTGACACCTTCTGGGTCGTCACCCCCACCCGGCTCCCCGCCGCGCG
CTTCGCGCTGAACCAGCCCGCGGACCTGCCCCAGGCGCTCGCGCGACGGCTGATGGCCTGGTGTCTGGAA
CACAACCTGGACTCCCTGGACACGCACTGGGCCCAGGGCCGGGAGCAACTGGAGCTCCTGGAGGTGGATG
CCTATGCCCCCTCCGTCCTCCCGCGCACGCCGCCGCGACCGGCCCAGCCCGCGCGACGCCGCCGGACCAA
GAATCCGGAGAAGGAAGACACCGCGCCCGAAACGCCAGAGCAGCGGGAGCAACGCCGCAACCGGCGGCGC
CTCACCCTGGTGGAGCTCCGGGCCGTGGCGCGCAACCTGAGCCACGGTGCGCGAGACGGCACGCTGGAAC
GTTGCTTCGGCCGGGAGGCGCTGGTTCGCGAGCTCGTAGAGGCGCTCGAAGGCCGCGAAGGCTCCGCGCT
GGTGCTGGTGGGTCCACCTGGCGCGGGCAAGACGGCCCTGATTCATGAAGCGGTGAGCCGGCTCACCGCC
CGGCAGGACGCCGCGGGCGTGCGTCGCGACGTGTGGCGCGTGGACGGCAACCAGTTCATCGCCGGGATGA
TGTACGTGGGCCAGTGGGAGGCCCGCGCGCGGGGCGTGGTGAAGGAGCTGATGGAGGTCGGCGACCTGCT
CTACGTGGACGACCTGGCCTCGCTCGTCTACGCGGGCCGCACGCGCAATGAGCGCACCAACGTCGCGCAG
TTCCTGGAGCCCCACATGGCCCGGGGCGAGCTCACCGTGCTCGCCGAGTCCACGCCCGAGCGCTTCGAGC
GCGTGCGGGAAGAAGCCCCCACCCTCGCCTCGCTCTTCCGGGTCATCCATGTCCCCGCGCTGGATGCGCG
TGCCACGCTGCCCGCGCTCCTCGGCACCGTGCGCGACCTGGAGGCGGAAGGCACGGACAGCGCGGTCCAG
CTCTCGCCGCTGGCGCTGGAGACCCTGCTCTCATTGCAGGAGCGCTTCGTGTCGCACGAGGCGTTCCCGG
GCAAGGCCGTCCGTCTGCTCCGCCGCGTCATGGCCCGACAGGGCGTCAGCACCTCGGGCACCCGGCGCTT
TTCGTCGGGGGACGTCATCGACGCGATGCGGGAGCAGACGGGCCTACCGGATTTCATCCTGGGAAGCGCC
CAGCCGAAGAAGCGCGAAGCGCTGACGTGGGAGATGCAGCGGCAGGTAGCGGGCCAGCCCGAAGCCGTGG
AAGCCGTGGTGGACGCCATCCTCACGTTGCAGTCCGCGCTCCAGCCGTCCGACAAGCCCCTGGCCACCTA
CCTCTTCGTGGGCCCCACGGGCGTGGGCAAGACGGAGACGGCGAAGGCGCTCGCGCGGACGCTCTTCGGC
GGAGAGCAGCGGCTCATCCGTTTCGACATGTCGGAGTTCGTCACGTCCTCCAGCATCACCCGGCTGCTCG
GGCGGCCCGGCGCGCCCGACGGTGAGCTGACCACCGCGCTGCGCACCCAGCCCTTCTGCGTGGTGCTGTT
TGACGAGGTGGAGAAGGCCCATCCCCGCGTGTTCGACGCCCTCCTCCAGTTCCTTGGTGAGGGACGGCTG
ACGGACGGAGCGGGACGCACGGTGGATGCCCGGCAGTCCGTCGTCGTGCTCACGAGCAACCTCGGCGTGC
GCGAGGCCGCCACCCACACCGGTTTCCACCGCGCCGCGGACAGCGCGGATGCGCACTACCTCTCCGCCGT
GCGTGCCTGGTTCCGCCCGGAGTTCTTCAACCGCCTGGACCGGGTGGTGCCCTTCCGTCCGCTCACGCCC
GCCGCGCTGCGCGTGGTGGTGGACCTCGCGCTCGAAGCCCTGCTGTCGCGCCATGGCATCCGGCAGGGCA
ACGTGCTGGTGGAGGTCGAGCCGCGCCTGCTGGACCTGCTGGTGGAGGAGGCCTACGACCCGCGCTACGG
AGCCCGCCCCCTCAAGCGCGCACTGGAGAAGCGCCTCACGTTGCCCCTGGCCCACCACCTGGTGCGGCGG
AGCGCGGACGACCTGGCGCGCGTGGAGCTGCTACGGGACGGCAACGACATGCGCGTGTCGGTGGAGGTGC
TGGTCAACGCGCCCGCGTGGGCGCCCGAGCGGCCGGCCTCTGCGTGGAGCCTGACCGAGGTTTCCCGCCT
GCTCGAGGAGACCCGCTCGCGGCTGGAGGCGTTGATGACGGAGGGGGTGCCCGAGGCGGGAGAACTGGCG
GAGCGACTGCACCGGCTGGCACTCGAGGCCACGGACATTCGCGACTACGAGTTGGTCCCGCGCGACTTCC
TGGACGCGGAGTCGCCTGCGTCCACCGTGAAGCAGATGCTGACGTCGCACTCGAGTCACGTGGGCCACCT
GGGCCTGCGGCAGCGCCCTGTGTATGAGGAGCGCCCACTGCACGTCTCGAACGAAGAACAGCTCCGCCGC
GCACAGCCCCGGGTGTTGGCCCTTCGCGACGAGACCGCCTGGGTCGAACATCAGCTCACGCACCTGGCGA
GGGGGACGGACGTCGTGACGGTGTTGGTGGAGGGGCTCGGCGACGCGACGCCATCCGCGGTGTGGACCGT
GGCCCACTCCCTCCCCAGCGCGCTCGGGGAGTCGGCGATGTACCTGGAAGCCGTCCATGCCGACGGGCGC
ACCGAGTGGCTCCGGTCCGGAGACGAGCGGTCCGAGGACCTGGTGCTTCGGCGTGTCGCCGTGCGGATGT
CGGCCATCGGCCTGCGCGAGGTGCTGGCGCCCCTTCGAGGCTATGCGCTGGTGGACCTCGTCTATGGCGA
TGGGCCACGCCAGGTCCTGGTCCGGCTGGAGCACCTGTCCGAAGACGTCGGGAGTCTGGAAGACGTGCCG
CGCGTGATGGCCGCATGGGATGAGGCAGTCGTCCGCGAACGCGATGCCCGGAGGAGCGGCGCCGCGTCAG
TGGGCGCGGCCAGCCACGTCATCCTGCGTGGCCGCGAAGGTGTCACGACTGGGCGGCCCCACGACTCGAC
CGAACTCACGCACGTCGCGAGCGGACGCCGCCCCCGGGAGGCGCTCGCATGGGCCGCGAGGGTGCTCCGG
GAACCCAGCCAGGGACACGACTGA
 Primer design