SecReT6
Protein ID: 108759244
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4806
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6013836..6015860 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1D306
KEGG IDmxa:MXAN_4806
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-17, Aligned region: 55..114
ImpA-rel_N [PF06812], Evalue: 3.40E-17, Aligned region: 143..171
TPR_16 [PF13432], Evalue: 0.00031, Aligned region: 97..124
TPR_16 [PF13432], Evalue: 0.00031, Aligned region: 177..190
TPR_16 [PF13432], Evalue: 0.00031, Aligned region: 367..385
TPR_16 [PF13432], Evalue: 0.00031, Aligned region: 441..471
TPR_16 [PF13432], Evalue: 0.00031, Aligned region: 554..613
TPR_21 [PF09976], Evalue: 0.005, Aligned region: 544..611
Protein Sequence: 674 a.a.     [Download]
>gi|108759244|ref|YP_632967.1| hypothetical protein MXAN_4806 [Myxococcus xanthus DK 1622]
MPPSLEQLRERALPWAEPVPGASPAGVQAKHEPAYEAVALEVAKLESPASNAVRWDDVVEGASELLKHTT
KDLWLASYMAYGLYATRGLDGAATGTAVLAEVTERYWQDLFPEAKRLRGRANAVAWFVDRLGRILPTVDQ
ASVSAEPLDALAVAVKRLAQLSRERFSDMAPAFGPLQDAIARLRAGLPEPEPESVPDGRTASSEDADASQ
PPVDGTASSQDEDTPSGEDGETVVRAADSANGTRPGAPSDSAETPTNGNGNRSAREAGNASANGKPAQAN
GAGNSAAPGKGNTAPGNPTAKNAPAPAKISTAQGTAKASAASQGGASANGTPAPPRAAIEVPPLPELPAA
PDLSSVEAITDFLRTVGGALLGAAGALRRASPEDPLSYRLNRMGLWLHLTQPPATDGNGRTQIHPLPDLL
GTKLETLEQNQRWGELLDESESALARHRFTLTLHRYSATALEGLGAAYAGARTALVQELAIQLRRMTGVE
TLISTLGSPLTDDATQDWLRDHVLRASAPPPAPSAAVASVSTTLALGPLSLGPSVHADSAALEAEARTLL
EEGRVHEAVTRLQAAVAAASTGRARFISRLELARLCANAGQLPLARAVYDALDEEVSAHALDTWEPALAA
ACLEGWLQTRTEAEKESGPVAVKFRNRYRRLALLDSSATLRVGA
 
Nucleotide Sequence: 2025 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6013836-6015860 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGCCTCCCTCCCTGGAACAGCTTCGTGAACGTGCCCTCCCCTGGGCCGAGCCCGTGCCGGGGGCGTCCC
CGGCCGGCGTGCAGGCGAAGCACGAGCCCGCATACGAGGCCGTCGCGCTGGAAGTCGCGAAGTTGGAGTC
TCCGGCCAGCAACGCCGTGCGCTGGGATGACGTCGTCGAGGGCGCCAGCGAGCTGCTGAAGCACACCACC
AAGGACCTCTGGCTCGCCTCGTACATGGCCTATGGCCTGTATGCCACGCGAGGCCTGGACGGCGCGGCCA
CCGGCACGGCCGTGCTCGCCGAGGTGACGGAGCGCTACTGGCAGGACCTCTTCCCGGAGGCGAAGCGGCT
GCGCGGCCGAGCCAACGCCGTGGCCTGGTTCGTGGACCGGCTGGGCCGCATCCTGCCCACCGTAGACCAG
GCCTCCGTGAGCGCGGAGCCCCTGGATGCGCTGGCGGTCGCGGTGAAGCGCCTGGCCCAGCTCTCACGCG
AGCGGTTCTCCGACATGGCCCCCGCGTTCGGGCCGCTCCAGGATGCCATCGCCCGGCTCCGCGCCGGACT
CCCCGAGCCCGAACCCGAGAGCGTACCGGATGGACGCACCGCGTCCTCGGAGGACGCAGACGCCTCGCAG
CCGCCGGTGGATGGGACTGCGTCGTCCCAGGACGAGGACACCCCGTCCGGCGAGGATGGAGAGACCGTTG
TGCGCGCGGCGGACTCCGCGAATGGCACGCGGCCAGGAGCGCCTTCGGACAGCGCTGAAACGCCCACGAA
CGGCAATGGCAACCGCTCCGCTCGGGAGGCGGGCAATGCCAGCGCCAACGGCAAACCTGCTCAAGCCAAC
GGTGCTGGAAACAGCGCCGCCCCGGGTAAAGGCAACACCGCCCCGGGCAATCCCACGGCGAAGAACGCCC
CCGCCCCGGCCAAAATCAGCACCGCTCAGGGCACCGCCAAAGCCAGCGCAGCCAGCCAGGGCGGCGCCTC
CGCCAACGGCACACCCGCACCACCGCGCGCCGCCATCGAAGTCCCGCCCCTCCCCGAGCTTCCCGCCGCC
CCGGATCTGTCCAGCGTGGAGGCGATCACCGACTTCCTGCGCACCGTGGGCGGCGCGCTGCTGGGAGCCG
CGGGCGCGCTGCGCCGGGCCAGCCCCGAGGATCCGCTCTCCTACCGCCTCAACCGCATGGGCCTGTGGTT
GCACCTGACCCAGCCGCCCGCCACGGATGGCAATGGCCGCACCCAGATTCACCCACTGCCGGACCTGCTG
GGAACCAAGCTGGAGACCCTGGAGCAGAACCAGCGCTGGGGCGAGCTGCTGGACGAGTCCGAGTCGGCCC
TGGCCCGCCACCGCTTCACGCTGACGCTCCACCGGTACAGCGCCACCGCCCTGGAGGGGCTGGGTGCCGC
GTACGCCGGGGCTCGCACCGCGCTGGTACAGGAATTGGCCATCCAGCTCCGCCGCATGACCGGCGTGGAG
ACGCTCATCTCCACCTTGGGAAGCCCGCTCACGGACGACGCCACCCAGGACTGGCTGCGCGACCACGTCC
TCCGCGCGAGCGCGCCCCCACCCGCCCCTTCCGCCGCCGTGGCGTCGGTGTCCACGACCCTGGCGCTGGG
GCCCCTGTCGCTGGGCCCGTCTGTCCATGCCGACAGCGCGGCGCTGGAAGCCGAAGCCCGCACGTTGCTG
GAGGAAGGCCGTGTCCACGAAGCTGTCACCCGGTTGCAGGCCGCCGTCGCCGCCGCCAGCACCGGCCGCG
CCCGCTTCATCTCCCGGCTGGAGCTGGCGCGGTTGTGTGCCAATGCGGGCCAGTTGCCGCTCGCGCGCGC
CGTCTATGACGCGCTGGACGAAGAGGTCTCCGCCCACGCGCTCGACACCTGGGAGCCAGCGCTCGCCGCC
GCGTGTCTGGAGGGGTGGCTGCAAACCCGCACCGAAGCCGAAAAGGAGTCTGGACCGGTGGCAGTGAAAT
TTCGAAACCGGTATCGTCGTCTAGCGTTGCTGGACTCTTCCGCCACGCTGCGCGTCGGCGCTTGA
 Primer design