SecReT6
Protein ID: 108759346
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4807
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6015943..6016437 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1D305
KEGG IDmxa:MXAN_4807
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-55, Aligned region: 6..158
Protein Sequence: 164 a.a.     [Download]
>gi|108759346|ref|YP_632968.1| hypothetical protein MXAN_4807 [Myxococcus xanthus DK 1622]
MSKESSVAPTERVNIVYKPATGNAQEQVELPLKVLMLGDFTGQEDARPLEQRAPINVDKANFNEVMAQQN
LKVTLTAADKLSADPNATMNVSLQFKNLNDFSPESVVNQVPELKKLLELRSALNALKGPLGNLPAFRKKL
QALLADEDGRKALIKELGLTEETK
 
Nucleotide Sequence: 495 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6015943-6016437 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGAGCAAAGAGAGTTCCGTCGCCCCTACCGAGCGCGTCAACATCGTCTACAAGCCCGCCACCGGCAACG
CGCAGGAGCAGGTGGAGCTGCCGCTGAAGGTGCTGATGCTGGGGGACTTCACGGGTCAGGAAGACGCCCG
TCCGCTGGAGCAGCGCGCGCCCATCAACGTGGACAAGGCCAACTTCAACGAAGTCATGGCCCAGCAGAAC
CTCAAGGTCACCCTGACCGCCGCCGACAAGCTTTCGGCGGACCCGAACGCCACGATGAACGTGTCGCTCC
AGTTCAAGAACCTGAATGACTTTTCGCCCGAGAGCGTCGTCAATCAGGTGCCGGAGCTGAAGAAGCTGCT
CGAGCTGCGCAGCGCGCTCAACGCCCTCAAGGGCCCCCTGGGCAACCTGCCGGCGTTCCGCAAGAAGCTC
CAGGCTCTGCTCGCCGACGAGGACGGACGCAAGGCGCTCATCAAGGAACTGGGTCTGACCGAAGAGACCA
AGTAG
 Primer design