SecReT6
Protein ID: 108759726
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4825
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6039087..6041597 [+]
ProductClpA/B family protein
NoteTssH
UniProt IDQ1D2Y7
KEGG IDmxa:MXAN_4825
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.70E-35, Aligned region: 303..374
AAA_2 [PF07724], Evalue: 5.70E-35, Aligned region: 395..411
AAA_2 [PF07724], Evalue: 5.70E-35, Aligned region: 573..733
AAA [PF00004], Evalue: 2.20E-16, Aligned region: 306..411
AAA [PF00004], Evalue: 2.20E-16, Aligned region: 579..654
ClpB_D2-small [PF10431], Evalue: 6.30E-16, Aligned region: 740..815
AAA_16 [PF13191], Evalue: 3.50E-13, Aligned region: 286..479
AAA_16 [PF13191], Evalue: 3.50E-13, Aligned region: 564..606
AAA_16 [PF13191], Evalue: 3.50E-13, Aligned region: 640..666
AAA_16 [PF13191], Evalue: 3.50E-13, Aligned region: 733..759
AAA_5 [PF07728], Evalue: 1.80E-08, Aligned region: 305..327
AAA_5 [PF07728], Evalue: 1.80E-08, Aligned region: 578..691
Sigma54_activat [PF00158], Evalue: 5.10E-06, Aligned region: 296..328
Sigma54_activat [PF00158], Evalue: 5.10E-06, Aligned region: 578..674
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 302..329
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 577..599
IstB_IS21 [PF01695], Evalue: 7.90E-05, Aligned region: 291..327
IstB_IS21 [PF01695], Evalue: 7.90E-05, Aligned region: 578..597
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 286..329
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 579..590
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 305..413
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 576..639
Hpr_kinase_C [PF07475], Evalue: 0.0012, Aligned region: 306..327
Hpr_kinase_C [PF07475], Evalue: 0.0012, Aligned region: 579..596
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 306..355
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 581..602
AAA_28 [PF13521], Evalue: 0.0037, Aligned region: 306..333
AAA_28 [PF13521], Evalue: 0.0037, Aligned region: 418..438
AAA_28 [PF13521], Evalue: 0.0037, Aligned region: 578..604
DUF258 [PF03193], Evalue: 0.0049, Aligned region: 291..331
DUF258 [PF03193], Evalue: 0.0049, Aligned region: 579..589
AAA_14 [PF13173], Evalue: 0.007, Aligned region: 305..326
AAA_14 [PF13173], Evalue: 0.007, Aligned region: 578..655
NACHT [PF05729], Evalue: 0.0073, Aligned region: 306..452
NACHT [PF05729], Evalue: 0.0073, Aligned region: 579..591
Protein Sequence: 836 a.a.     [Download]
>gi|108759726|ref|YP_632986.1| ClpA/B family protein [Myxococcus xanthus DK 1622]
MRQSSANAMPGGAAPRQWARPATSSCVAAKVSRLGGPTTRPNSRTSRADAAPGRRSHGPRGCSGNPARDT
TDMEKNVHLFVRTYPGLGVAAHVLTHPHLAAFAPTLHAARLDIAAVVGRLLKRGELWDEETHWSDLRQRK
TTLTVRALEHGKMLSVPLRLTVLTHGVKARTARKGAPARQSLRVWVPRVDVKGTLHDAADLEPFVEEMVR
HELYLASLDRLHSLAYVGEEQVETLSVPVRFRDTPRARALDAAKPQRRQAPPPGLAEASRCLNEEARAGL
LERAWERDLEVSRLAEAVTSRTRASVLLVGPSSVGKTALVHELVQRAEAATTGSPLHGLEVFSSSGGRIM
AGMRYLGQWQERVKHMVEALRVRQAVLHLDSLSELLSLGSGDTGLDVARQLLPALESGEVSLVLEATPED
VARAERTHAAFLQSLRHIAVAPLSAQAARNALQQASHRVGRARKVRFTPDALDRAGELTERFGSGPSPGG
AVSLLRAASTEPGAAGEVNAASVTRAFCTRTGYPLELVDSAIRLDPDALLRRFRERVVGQDEATLLLRNL
VVTLKTGLADPSRPLGAFLLLGPTGVGKTESALALAEYLFGDVARLARFDMAEYAAPGSATRLVGEAGGQ
QGSLARRVREQPFGVVLLDEIEKADAGVHDLLLQVLGEGRLTDATGRTVSFRNTVVLLTSNLGADSAGRS
LGFGERGPLERAAHYLGAAAAFFRPELLNRLDRVVPYRALTEDVIQSLARRTLEAALSREGLSRRGVKVT
FDEDVVKHLARTGFDARYGARPLKRAVEQQVVAPLARWLAAQATSAPPQVVLRVEAEGRIALSGLE
 
Nucleotide Sequence: 2511 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6039087-6041597 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGAGGCAGTCGTCCGCGAACGCGATGCCCGGAGGAGCGGCGCCGCGTCAGTGGGCGCGGCCAGCCACGT
CATCCTGCGTGGCCGCGAAGGTGTCACGACTGGGCGGCCCCACGACTCGACCGAACTCACGCACGTCGCG
AGCGGACGCCGCCCCCGGGAGGCGCTCGCATGGGCCGCGAGGGTGCTCCGGGAACCCAGCCAGGGACACG
ACTGACATGGAAAAGAACGTCCACCTCTTCGTGCGCACCTATCCCGGGCTGGGCGTGGCGGCGCACGTCC
TCACCCACCCGCACCTGGCGGCCTTCGCGCCGACGCTGCACGCCGCGAGGCTCGACATCGCTGCGGTGGT
GGGGCGGCTCCTCAAGCGAGGAGAGCTCTGGGACGAGGAGACCCACTGGAGCGATTTGCGCCAGCGGAAG
ACGACGCTGACGGTGCGCGCGCTCGAACACGGGAAGATGCTGTCCGTCCCCCTGCGCCTCACCGTGCTCA
CGCACGGGGTGAAGGCCCGCACCGCACGCAAGGGAGCACCAGCGCGCCAGTCCCTACGCGTGTGGGTGCC
CCGCGTGGACGTCAAGGGCACGCTGCACGATGCGGCGGACCTGGAGCCCTTCGTCGAGGAGATGGTCCGC
CACGAGCTCTATCTCGCGTCGCTCGACCGGCTGCACTCTCTGGCCTACGTGGGCGAGGAGCAGGTAGAGA
CGCTGTCGGTGCCGGTCCGCTTCCGGGACACGCCGCGTGCCCGTGCGCTCGATGCCGCGAAGCCGCAGCG
GCGCCAGGCGCCACCACCGGGGCTCGCGGAAGCCAGCCGGTGTCTCAATGAGGAAGCACGCGCGGGTTTG
CTGGAGCGCGCCTGGGAACGGGACCTGGAGGTGTCCCGGCTCGCGGAGGCCGTCACCTCGCGCACCCGTG
CCAGCGTGCTCCTGGTAGGCCCGTCGTCCGTGGGCAAGACGGCCCTGGTTCATGAACTCGTGCAACGCGC
GGAGGCGGCCACCACGGGTTCGCCGCTTCACGGGTTGGAGGTCTTCAGCTCCTCCGGAGGCCGCATCATG
GCGGGCATGCGCTACCTGGGGCAGTGGCAGGAGCGCGTGAAGCACATGGTGGAGGCCCTGCGTGTTCGCC
AGGCCGTGCTGCACCTCGACAGCCTGTCGGAGCTGCTGTCCCTGGGTAGCGGCGACACGGGGCTGGATGT
GGCGCGTCAGTTGCTCCCCGCATTGGAAAGTGGCGAGGTCTCACTCGTCCTGGAGGCAACACCGGAGGAC
GTGGCCCGCGCGGAGCGGACCCACGCAGCGTTCCTGCAATCGCTCCGGCACATCGCCGTGGCGCCCCTTT
CGGCCCAGGCCGCACGCAACGCGCTTCAGCAGGCCTCGCATCGGGTGGGCCGCGCTCGCAAGGTGCGCTT
CACGCCCGACGCGCTGGACCGCGCTGGCGAACTCACGGAGCGCTTCGGCTCGGGCCCTTCGCCCGGAGGC
GCGGTGTCCCTGCTGCGCGCCGCCAGCACGGAGCCCGGCGCGGCCGGAGAAGTGAACGCCGCTTCGGTGA
CGCGCGCCTTCTGCACTCGGACGGGGTACCCGCTCGAACTGGTGGACTCCGCCATCCGGTTGGACCCGGA
TGCCCTGCTCCGCCGCTTCCGCGAGCGCGTGGTGGGCCAGGACGAGGCCACCCTCCTCCTGCGCAATCTG
GTCGTCACGCTGAAAACAGGCCTGGCGGACCCCTCGCGTCCGCTGGGCGCCTTCCTGCTGCTGGGTCCCA
CCGGCGTGGGCAAGACGGAGTCGGCGCTCGCGCTGGCGGAGTACCTGTTTGGCGACGTGGCCCGGCTGGC
GCGCTTCGACATGGCGGAGTACGCCGCGCCAGGCAGCGCCACCCGGCTGGTGGGAGAAGCGGGAGGCCAA
CAAGGCAGCCTGGCGCGGCGCGTCCGCGAGCAGCCCTTCGGCGTGGTGCTGCTGGACGAAATCGAGAAAG
CGGACGCGGGCGTCCATGACCTGCTGTTGCAGGTGCTCGGCGAAGGCCGGCTCACGGATGCCACCGGCCG
CACCGTCAGCTTCCGCAACACCGTGGTGCTGCTCACCAGCAACCTGGGCGCGGACAGCGCGGGGCGCTCG
CTGGGTTTCGGGGAGCGCGGCCCCCTGGAGCGGGCGGCGCACTACCTGGGGGCCGCGGCGGCCTTCTTCC
GGCCGGAGTTGCTGAACCGGTTGGACCGGGTGGTGCCCTACCGCGCGCTCACGGAGGACGTCATTCAATC
ACTCGCCCGGCGCACGTTGGAGGCGGCCCTCTCTCGCGAGGGGCTCAGTCGCCGGGGCGTGAAGGTGACC
TTCGACGAGGACGTGGTGAAGCACCTGGCGCGCACCGGCTTCGACGCACGCTATGGGGCCAGGCCTCTCA
AGCGCGCCGTGGAGCAACAGGTGGTCGCGCCCCTGGCGCGGTGGTTGGCGGCTCAGGCCACCAGCGCTCC
GCCCCAGGTGGTGCTCCGCGTGGAAGCTGAGGGGCGGATTGCGTTGAGCGGCCTCGAATGA
 Primer design