SecReT6
Protein ID: 108761289
SecReT6 ID127
T6SS typei1
Gene symbolclpC
Locus tagMXAN_4832
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6046572..6049226 [-]
ProductATP-dependent Clp protease, ATP-binding subunit ClpC
NoteTssH
UniProt IDQ1D2Y0
KEGG IDmxa:MXAN_4832
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-57, Aligned region: 272..355
AAA_2 [PF07724], Evalue: 1.90E-57, Aligned region: 605..769
AAA [PF00004], Evalue: 1.70E-27, Aligned region: 273..404
AAA [PF00004], Evalue: 1.70E-27, Aligned region: 611..735
ClpB_D2-small [PF10431], Evalue: 2.90E-24, Aligned region: 776..855
Clp_N [PF02861], Evalue: 9.30E-24, Aligned region: 94..143
Clp_N [PF02861], Evalue: 9.30E-24, Aligned region: 166..217
Clp_N [PF02861], Evalue: 9.30E-24, Aligned region: 792..814
AAA_5 [PF07728], Evalue: 1.10E-19, Aligned region: 273..352
AAA_5 [PF07728], Evalue: 1.10E-19, Aligned region: 398..491
AAA_5 [PF07728], Evalue: 1.10E-19, Aligned region: 610..731
AAA_5 [PF07728], Evalue: 1.10E-19, Aligned region: 863..877
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 250..295
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 311..351
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 386..470
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 582..646
AAA_16 [PF13191], Evalue: 2.40E-14, Aligned region: 676..705
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 270..353
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 608..704
Sigma54_activat [PF00158], Evalue: 5.00E-10, Aligned region: 254..296
Sigma54_activat [PF00158], Evalue: 5.00E-10, Aligned region: 603..739
Arch_ATPase [PF01637], Evalue: 1.80E-08, Aligned region: 251..421
Arch_ATPase [PF01637], Evalue: 1.80E-08, Aligned region: 611..633
Arch_ATPase [PF01637], Evalue: 1.80E-08, Aligned region: 677..692
AAA_18 [PF13238], Evalue: 8.90E-08, Aligned region: 274..397
AAA_18 [PF13238], Evalue: 8.90E-08, Aligned region: 612..635
AAA_14 [PF13173], Evalue: 2.00E-07, Aligned region: 273..355
AAA_14 [PF13173], Evalue: 2.00E-07, Aligned region: 612..707
RuvB_N [PF05496], Evalue: 3.20E-06, Aligned region: 272..293
RuvB_N [PF05496], Evalue: 3.20E-06, Aligned region: 340..353
RuvB_N [PF05496], Evalue: 3.20E-06, Aligned region: 561..630
RuvB_N [PF05496], Evalue: 3.20E-06, Aligned region: 680..708
AAA_17 [PF13207], Evalue: 4.20E-06, Aligned region: 274..338
AAA_17 [PF13207], Evalue: 4.20E-06, Aligned region: 614..654
IstB_IS21 [PF01695], Evalue: 6.50E-06, Aligned region: 268..296
IstB_IS21 [PF01695], Evalue: 6.50E-06, Aligned region: 610..629
Mg_chelatase [PF01078], Evalue: 6.30E-05, Aligned region: 269..290
Mg_chelatase [PF01078], Evalue: 6.30E-05, Aligned region: 609..632
AAA_19 [PF13245], Evalue: 0.00016, Aligned region: 270..297
AAA_19 [PF13245], Evalue: 0.00016, Aligned region: 612..631
NACHT [PF05729], Evalue: 0.00029, Aligned region: 273..296
NACHT [PF05729], Evalue: 0.00029, Aligned region: 612..636
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 272..293
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 387..419
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 602..663
MMR_HSR1 [PF01926], Evalue: 0.00037, Aligned region: 273..348
MMR_HSR1 [PF01926], Evalue: 0.00037, Aligned region: 611..634
AAA_3 [PF07726], Evalue: 0.00072, Aligned region: 274..293
AAA_3 [PF07726], Evalue: 0.00072, Aligned region: 615..728
RNA_helicase [PF00910], Evalue: 0.00075, Aligned region: 274..296
RNA_helicase [PF00910], Evalue: 0.00075, Aligned region: 611..632
AAA_28 [PF13521], Evalue: 0.0013, Aligned region: 273..305
AAA_28 [PF13521], Evalue: 0.0013, Aligned region: 610..630
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 273..290
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 500..574
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 608..734
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 254..292
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 610..629
AAA_29 [PF13555], Evalue: 0.0022, Aligned region: 268..290
AAA_29 [PF13555], Evalue: 0.0022, Aligned region: 608..636
NTPase_1 [PF03266], Evalue: 0.0045, Aligned region: 274..295
NTPase_1 [PF03266], Evalue: 0.0045, Aligned region: 324..350
NTPase_1 [PF03266], Evalue: 0.0045, Aligned region: 614..633
AAA_24 [PF13479], Evalue: 0.0052, Aligned region: 273..288
AAA_24 [PF13479], Evalue: 0.0052, Aligned region: 610..641
ResIII [PF04851], Evalue: 0.0053, Aligned region: 257..295
ResIII [PF04851], Evalue: 0.0053, Aligned region: 333..354
ResIII [PF04851], Evalue: 0.0053, Aligned region: 582..630
ABC_tran [PF00005], Evalue: 0.0074, Aligned region: 273..293
ABC_tran [PF00005], Evalue: 0.0074, Aligned region: 612..633
AAA_25 [PF13481], Evalue: 0.0076, Aligned region: 273..310
AAA_25 [PF13481], Evalue: 0.0076, Aligned region: 590..628
Protein Sequence: 884 a.a.     [Download]
>gi|108761289|ref|YP_632993.1| ATP-dependent Clp protease, ATP-binding subunit ClpC [Myxococcus xanthus DK 1622]
MANVCDLCHQRPATTRVTRVMGNRRTTESLCDVCSSQRSRFGRMGLGTSLFDQFFSDFGDEDFGGLSRSL
QQPVERYDITEAFSDETRRVLEAAFEAARSAGAASIDTEHLLVALAKDPLGRTALSRMKLDPARVAERAE
SEMRRGKRPMERPELSPHAKRALELAYQEAYELGHSYVGPEHVLLGLLHEGEGLASEILREQGAQHGKAR
AAVAEALAPSSEARRSPTPTLDEYCRDLTSLASEGKLDPVVGRANEIETTLEILSRRTKNNPVLIGEPGV
GKTAIVEGIAQRIISAAVPDTLRDKRVLQLDLSGLLAGSKYRGEFEERLKKVMDEVKSHSEDIVLFIDEI
HTIVGAGAAEGAMDAGNMLKPSLARGELHVIGATTLDEYRKRIEKDAALERRFQPVVVPEPTAEQAIEIL
RGLKDRYESHHRVRIADEALVAAVELSDRYVTGRFLPDKAIDLVDQAAARVRLRLTLPPERLVNAEHEVV
KVKRSLDEARGRKAGPRIQELESKLNAAEREVQSAQKERRTQKSGETPEVRAEDVAEVLSRMTGIPVTQM
TEDERKKLLELESRLHERVIGQDEAIRVLSQAIRRARAGLKDESRPIGSFLFLGPTGVGKTELAKTLAEL
LFGDEKALIRFDMSEYMEKHTVSRLVGAPPGYVGYEEGGQLTEAVRRRPYSVLLFDEVEKAHPDVFHMLL
QVLDDGRLTDAQGTVVNFKNTVIIGTSNLGSHLIQESTARKEPQERMRERVMGVLKGHFPPEFLNRIDET
VVFEPLNRAQLRAIVDLMLEKTRRLLHGQGIDLEVTPAALEALVDKGWDPTFGARPLRREIQRAIEAPLA
EKLISGDIHENSRVRADFKDGKFRFDEVEAAEAEVAQAEASAVH
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|108756767|ref|NC_008095.1|:c6049226-6046572 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGCCAATGTCTGCGACCTCTGCCACCAGCGCCCGGCGACCACCCGAGTCACCCGCGTCATGGGGAACC
GGCGGACCACCGAGTCCCTGTGTGACGTCTGTAGCAGCCAGCGCTCGCGCTTCGGCCGCATGGGCCTGGG
CACGTCGCTCTTCGACCAGTTCTTCAGTGACTTCGGAGACGAGGACTTCGGGGGGCTGTCGCGTTCACTC
CAGCAGCCGGTGGAGCGCTACGACATCACCGAGGCCTTCTCCGATGAGACGCGGCGCGTATTGGAAGCGG
CCTTCGAGGCGGCGCGAAGCGCGGGGGCGGCTTCCATCGACACGGAGCACCTGCTGGTGGCGCTCGCGAA
GGACCCGCTGGGCCGGACCGCGCTCAGCCGCATGAAGCTGGACCCGGCCCGCGTCGCCGAGCGCGCCGAG
TCCGAGATGCGCCGTGGGAAGCGCCCCATGGAGCGTCCCGAGCTGTCGCCGCATGCGAAGCGCGCCCTGG
AACTCGCGTACCAGGAGGCCTACGAGCTGGGACATTCCTATGTGGGGCCCGAACACGTGCTGCTGGGGTT
GCTGCACGAAGGGGAAGGCCTGGCGTCGGAGATTCTGCGCGAGCAAGGGGCCCAGCACGGCAAGGCGCGC
GCGGCCGTCGCGGAAGCGCTGGCACCTTCATCCGAGGCACGCCGGTCGCCCACGCCCACGCTGGACGAGT
ACTGCCGCGACCTGACGAGCCTGGCCTCGGAAGGGAAGCTGGACCCGGTGGTGGGGCGGGCCAACGAAAT
CGAGACCACGCTCGAAATCCTCTCGCGTCGTACGAAGAACAACCCCGTGCTCATTGGTGAGCCGGGCGTG
GGCAAGACGGCCATCGTGGAGGGCATTGCCCAGCGCATCATCTCCGCCGCGGTCCCGGACACGCTGCGCG
ACAAACGCGTGCTGCAACTGGACCTGTCCGGCCTGCTCGCGGGCAGCAAGTACCGCGGTGAGTTCGAGGA
GCGGCTGAAGAAGGTCATGGACGAGGTGAAGTCGCACAGCGAGGACATCGTCCTCTTCATCGACGAGATT
CACACCATCGTCGGGGCGGGCGCGGCGGAGGGGGCCATGGATGCGGGCAACATGCTCAAGCCATCCCTGG
CGCGCGGCGAGCTGCACGTCATCGGCGCGACGACGTTGGATGAATACCGCAAGCGCATCGAGAAGGATGC
TGCGCTCGAACGCCGCTTCCAGCCCGTGGTCGTCCCGGAGCCGACGGCCGAGCAGGCCATTGAGATTCTG
CGAGGCCTCAAGGACCGCTACGAGTCCCACCACCGCGTGCGCATCGCGGACGAGGCGCTGGTGGCGGCGG
TGGAGCTGTCGGACCGTTACGTCACAGGGCGCTTCCTGCCGGACAAGGCCATCGACCTGGTGGACCAGGC
GGCGGCCCGCGTGCGCTTGCGGCTCACGCTGCCACCGGAGCGACTGGTGAATGCCGAGCATGAGGTGGTG
AAGGTGAAGCGCTCGCTCGACGAGGCTCGCGGCCGGAAGGCGGGGCCGCGCATCCAGGAGCTGGAGTCGA
AGCTGAACGCCGCCGAGCGCGAGGTCCAGAGCGCGCAGAAGGAGCGCCGCACGCAGAAGTCCGGTGAGAC
GCCGGAGGTCCGCGCCGAGGACGTGGCGGAGGTGCTGTCGCGCATGACGGGCATCCCCGTGACGCAGATG
ACGGAGGACGAGCGCAAGAAGCTGCTGGAGCTGGAGTCGCGGCTGCACGAGCGCGTCATCGGTCAGGACG
AGGCCATCCGCGTGTTGTCCCAGGCCATCCGGCGGGCGAGGGCGGGGCTCAAGGACGAGTCGCGCCCCAT
CGGCTCCTTCCTCTTCCTGGGCCCCACGGGCGTGGGCAAGACGGAGTTGGCGAAGACGCTGGCGGAGCTG
CTCTTCGGTGACGAGAAGGCGCTCATCCGCTTCGACATGAGTGAGTACATGGAGAAGCACACCGTGAGCC
GGCTGGTGGGCGCGCCGCCGGGCTATGTCGGCTACGAGGAGGGCGGGCAGCTCACCGAGGCCGTGCGGCG
GCGGCCCTACTCCGTGCTCCTCTTCGACGAGGTGGAGAAGGCCCACCCCGACGTGTTCCACATGCTGCTC
CAGGTGCTGGATGACGGGCGGCTCACGGACGCGCAGGGCACGGTGGTGAACTTCAAGAACACCGTCATCA
TCGGCACCAGCAACCTGGGCTCGCACCTCATCCAGGAGTCCACCGCGCGCAAGGAACCGCAGGAGCGCAT
GCGGGAGCGCGTCATGGGCGTGCTCAAGGGGCACTTCCCGCCCGAGTTCCTCAACCGCATCGACGAGACG
GTGGTCTTCGAGCCGCTCAACCGCGCGCAGCTGCGCGCCATCGTGGACCTGATGCTGGAGAAGACGCGCC
GCCTGCTGCACGGCCAGGGCATTGACCTGGAGGTGACGCCCGCGGCGCTGGAAGCGCTGGTGGACAAGGG
ATGGGACCCAACCTTCGGCGCGCGTCCGCTGCGGCGTGAAATCCAGCGCGCCATCGAGGCGCCACTCGCG
GAGAAGCTCATCTCGGGCGACATCCATGAGAACAGCCGCGTGAGAGCGGACTTCAAGGACGGAAAATTCC
GGTTCGACGAAGTGGAGGCCGCTGAGGCGGAAGTCGCGCAGGCTGAAGCGAGTGCCGTTCACTGA
 Primer design