SecReT6
Protein ID: 108761628
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4801
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6006481..6007098 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ1D311
KEGG IDmxa:MXAN_4801
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-26, Aligned region: 24..145
Protein Sequence: 205 a.a.     [Download]
>gi|108761628|ref|YP_632962.1| hypothetical protein MXAN_4801 [Myxococcus xanthus DK 1622]
MWSAGRNLRWGVVIALAAALSGSAGCVKRVPQACETPPPFQVVVDASEQLNPDARGRSLPTVVQIVQLKD
SVRLERAGFKDLWGKPEEFLKEDLLQVAELVIPPGRQVKRWVQRDPKARFVLAMGHFRQPLGYSWRTVAA
LPVVEEARCVERPAGDQGDPKPGDEVFRYRLQGYQIDLMFRPMTQAPEPRLQPQAGDGVSPRRGV
 
Nucleotide Sequence: 618 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6006481-6007098 Myxococcus xanthus DK 1622 chromosome, complete genome
GTGTGGAGTGCCGGCCGGAACCTCCGGTGGGGTGTGGTCATCGCGCTCGCGGCCGCCTTGAGCGGGAGCG
CGGGCTGCGTGAAGCGTGTGCCCCAGGCGTGTGAGACGCCGCCGCCGTTCCAGGTGGTGGTGGATGCGTC
GGAGCAGCTCAATCCCGACGCGCGCGGGCGCTCGCTGCCCACCGTGGTGCAGATCGTCCAGCTCAAGGAC
AGCGTCCGGCTGGAGCGCGCGGGCTTCAAGGACCTGTGGGGCAAGCCGGAGGAGTTCCTCAAGGAGGACC
TGCTCCAGGTGGCCGAGCTGGTGATTCCGCCCGGCCGCCAGGTGAAGCGCTGGGTGCAGCGTGATCCGAA
GGCCCGCTTCGTCCTGGCCATGGGGCACTTCCGGCAGCCGCTGGGCTATTCGTGGCGAACGGTGGCGGCG
CTCCCCGTGGTGGAGGAAGCGCGCTGCGTGGAGCGCCCCGCGGGTGACCAGGGCGACCCGAAGCCGGGGG
ACGAGGTCTTCCGCTACCGGCTGCAAGGCTATCAGATTGACCTGATGTTCCGGCCCATGACGCAGGCGCC
GGAGCCTCGACTCCAACCCCAAGCAGGCGACGGCGTGTCGCCGCGGAGAGGTGTATGA
 Primer design