SecReT6
Protein ID: 108761699
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4804
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6009191..6012886 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ1D308
KEGG IDmxa:MXAN_4804
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.10E-79, Aligned region: 173..433
ImcF-related_N [PF14331], Evalue: 4.10E-79, Aligned region: 481..500
IcmF-related [PF06761], Evalue: 2.30E-34, Aligned region: 361..405
IcmF-related [PF06761], Evalue: 2.30E-34, Aligned region: 481..804
DUF1215 [PF06744], Evalue: 2.10E-25, Aligned region: 935..1047
AAA_16 [PF13191], Evalue: 0.0011, Aligned region: 113..216
AAA_16 [PF13191], Evalue: 0.0011, Aligned region: 763..763
AAA_17 [PF13207], Evalue: 0.0056, Aligned region: 116..140
AAA_17 [PF13207], Evalue: 0.0056, Aligned region: 317..341
AAA_17 [PF13207], Evalue: 0.0056, Aligned region: 584..584
AAA_17 [PF13207], Evalue: 0.0056, Aligned region: 714..740
Protein Sequence: 1231 a.a.     [Download]
>gi|108761699|ref|YP_632965.1| hypothetical protein MXAN_4804 [Myxococcus xanthus DK 1622]
MMAYLLPLLGIGAPMFALMTYLGLTMQQAAIVAALAGLLAAGVVWLVKRIRARAAAKKLEGALAAQADEQ
ATTVRPDLQPEIKAMQSEFTKAVEALKASKLARGGKDALAVLPWYLIVGPPGAGKSTALRNSGLKFPYLS
ARGGVRGVGGTRNCDWWLTNEAVLLDTAGRYTSAEEDRPEWLAFLDTVAKHRPSRPINGLIVAISVSELL
NADPQAVGEMGQTIRERLDEITTRLKMLVPVYVMITKCDLLPGFVEMFSDLSRVERGQIWGFTVPLEQQR
EASTDLFRERFDQMLSVLEQRSLRRLGQERRLETREKIYGFPQKFDALRKNLAEFLQPLFLENVFQDTPV
FRGLYFNSGTQELRPVDKVSPSAAEIFGSTNGRAQTDGATDGRSYFLWDVFTKVMFQDQQVAVRSSLEEA
RVRRQRMMLASAASAATVLLLSLPTVSFFKNRNMAEAVTEAITSVNLDPRDDIRRVEDLIPLRNRLQELT
EYEEGSAPVFMRFGLYQGQKLLPQARQFYNAALRRVLLGKQFELIQQRLDTFGKNPDLLTVRSDEDYSKH
FDAYRQYFDDLKMYLLVTTPRDPREPELDELQRKWLQDEIVKHWKRVRGDAVDERAVANHAETFLLMLAN
EQMLPEERKPAREQRIAFGRVTGVVQSARRSLNNVPLVRLELAQLVANMSGAYPDVTLEQLVGSVPQMSA
TSRVRGAFTRKAYDDVIRERLDLAFQDQQSWVLDRDEKVDTVSSRRELRTRYFEAYTQEWKDFLGAIRVQ
APENLTQMESLLTNLTRGKPKPYGRLFRALTYNVVLDKRDAKAAEADTGFLAKAGKLFGSEPGKDVPQKR
ELLNANSPSGAQEVTARDLEREFASLIRFATETSKTEDGEESLTALDSYEDQLATVQTTLLAVKDKPAES
GLLLDKIESTRNNVEMMVRKQTDNVAIFERLLLPPFQEMRSVVFVGVACNKSKLWQDQVVMAWSSAFKGK
YPFDRASQADAPLPEVAEFLRPEGGLVRKFVKEQLLEDVVATGRRWEFTSSGGVMYRPDLLGFLEKTGAL
STTLFPGGDTVDPLVRFQVRLRPGVSADGMASQISSITLTLDGTDETYRNGPDTVWKPMIWPGQAGKLGA
RITVQSADGSTETTLEAEGDWGLFRLLERVKRIEPSADGRYFTATWEIEEMNGALVSIDFRPERTANPFF
GMSGNTSKLLAIFRDPGLQPPTTIARKGECAPQAIAADRVH
 
Nucleotide Sequence: 3696 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6009191-6012886 Myxococcus xanthus DK 1622 chromosome, complete genome
GTGATGGCGTACCTGTTACCGCTGTTGGGCATCGGCGCGCCGATGTTCGCCCTGATGACCTACCTGGGCC
TCACCATGCAGCAGGCGGCCATCGTCGCCGCGCTCGCGGGCCTGCTGGCCGCCGGCGTGGTGTGGCTGGT
CAAGCGCATCCGCGCGCGCGCCGCCGCCAAGAAGCTGGAGGGCGCGCTGGCGGCCCAGGCGGATGAGCAG
GCCACCACCGTGCGGCCGGACCTGCAGCCTGAAATCAAGGCCATGCAGTCGGAGTTCACCAAGGCGGTGG
AGGCGCTCAAGGCCTCCAAGCTGGCGCGCGGTGGCAAGGACGCGCTGGCGGTGCTGCCCTGGTACCTCAT
CGTCGGTCCACCGGGCGCCGGCAAGAGCACCGCGCTGCGCAACTCCGGGCTGAAGTTCCCGTATCTCTCC
GCGCGCGGCGGCGTGCGCGGCGTGGGCGGCACGCGCAACTGTGACTGGTGGCTGACCAACGAGGCCGTGC
TGCTGGACACAGCCGGCCGCTACACCAGCGCGGAAGAGGACCGGCCGGAGTGGCTGGCCTTCCTGGACAC
GGTGGCGAAGCACCGCCCCAGCCGTCCCATCAACGGCCTCATCGTGGCCATCAGCGTCAGCGAGCTGCTG
AACGCGGACCCGCAGGCCGTGGGGGAGATGGGGCAGACCATCCGCGAGCGCCTGGATGAAATCACGACCC
GGCTGAAGATGCTGGTGCCGGTGTACGTGATGATCACCAAGTGCGACCTGCTGCCCGGCTTCGTGGAGAT
GTTCTCCGACCTGTCGCGCGTGGAGCGCGGGCAGATCTGGGGCTTCACCGTGCCGCTGGAGCAGCAGCGC
GAGGCGAGCACGGACCTGTTCCGCGAGCGCTTCGACCAGATGCTCTCCGTGCTGGAGCAGCGCTCGCTGC
GCCGGCTGGGCCAGGAGCGCCGGCTGGAGACGCGCGAGAAGATCTACGGCTTCCCGCAGAAGTTCGACGC
GCTCCGGAAGAACCTGGCGGAGTTCCTCCAGCCGCTCTTCCTGGAGAACGTGTTCCAGGACACGCCCGTC
TTCCGCGGCCTCTACTTCAACAGCGGCACGCAGGAGCTGCGCCCGGTGGACAAGGTGTCCCCGTCCGCGG
CGGAGATCTTCGGCAGCACCAACGGCCGGGCGCAGACGGATGGCGCCACGGACGGCCGCAGCTACTTCCT
CTGGGACGTCTTCACCAAGGTGATGTTCCAGGACCAGCAGGTGGCCGTGCGCAGCTCGCTGGAGGAAGCG
AGGGTGCGCCGCCAGCGGATGATGTTGGCCAGCGCGGCCTCCGCCGCCACGGTGCTGCTGCTGTCGCTAC
CCACGGTGTCCTTCTTCAAGAACCGCAACATGGCGGAGGCCGTCACCGAGGCCATCACCAGTGTGAATCT
GGACCCGCGTGACGACATCCGCCGCGTCGAGGACCTGATTCCGCTGCGCAACCGGCTCCAGGAGCTGACG
GAGTACGAGGAAGGCAGCGCCCCGGTGTTCATGCGCTTCGGCCTCTACCAGGGCCAGAAGCTGCTGCCGC
AGGCGCGGCAGTTCTACAACGCGGCGCTGCGCAGGGTGCTGCTCGGCAAGCAGTTCGAGCTCATCCAGCA
GCGCCTGGACACGTTCGGGAAGAACCCGGACCTGCTGACGGTGCGCAGCGACGAGGACTACAGCAAGCAC
TTCGACGCGTACCGCCAGTACTTCGACGACTTGAAGATGTACCTGCTGGTGACCACGCCCCGCGACCCGC
GCGAGCCGGAGCTGGACGAACTGCAGCGCAAGTGGCTCCAGGACGAAATCGTCAAGCACTGGAAGCGCGT
GCGGGGCGACGCGGTGGACGAGCGGGCCGTGGCGAACCACGCGGAGACGTTCCTGCTGATGCTCGCCAAC
GAGCAGATGCTCCCCGAGGAGCGGAAGCCGGCGCGCGAGCAGCGCATCGCCTTCGGCCGCGTCACCGGCG
TGGTGCAGTCGGCGCGCCGCTCGCTCAACAACGTGCCCCTGGTGCGGTTGGAGCTGGCGCAGTTGGTGGC
CAACATGAGCGGCGCGTACCCGGACGTGACGCTGGAGCAGCTCGTGGGCTCGGTGCCGCAGATGAGCGCC
ACCTCGCGCGTGCGGGGCGCCTTCACGCGCAAGGCCTACGACGACGTCATCCGCGAGCGGCTGGACCTGG
CCTTCCAGGACCAGCAGTCGTGGGTGCTGGACCGCGATGAGAAGGTGGACACGGTGAGCTCGCGGCGCGA
GCTGCGCACCCGCTACTTCGAGGCCTACACCCAGGAGTGGAAGGACTTCCTCGGCGCCATCCGTGTGCAG
GCACCGGAGAACCTGACGCAGATGGAGAGCCTGCTGACGAACCTGACGCGTGGCAAGCCCAAGCCCTACG
GGCGGCTGTTCCGCGCGCTCACGTACAACGTGGTGCTCGACAAGCGCGACGCCAAGGCGGCGGAGGCCGA
CACGGGCTTCCTGGCCAAGGCGGGGAAGCTGTTCGGCTCGGAGCCCGGGAAGGACGTGCCGCAGAAGCGC
GAGCTGCTGAACGCCAACTCACCTTCCGGCGCCCAGGAAGTCACGGCCCGTGACCTGGAGCGCGAGTTCG
CCTCGCTCATCCGCTTCGCCACGGAGACCTCCAAGACGGAGGACGGTGAGGAGTCCCTGACGGCGCTGGA
TTCGTATGAAGACCAGCTGGCCACCGTCCAGACGACGCTGCTGGCGGTGAAGGACAAGCCGGCCGAGTCC
GGCCTGCTGTTGGACAAGATTGAGTCCACCCGCAACAACGTGGAGATGATGGTCCGCAAGCAGACGGACA
ACGTCGCCATCTTCGAGCGGCTGCTGCTGCCGCCGTTCCAGGAGATGCGCTCGGTGGTGTTCGTGGGCGT
GGCCTGCAACAAGAGCAAGCTGTGGCAGGACCAGGTGGTGATGGCGTGGAGCAGCGCCTTCAAGGGCAAG
TACCCGTTTGACCGCGCGTCGCAGGCAGACGCGCCGCTGCCCGAGGTCGCGGAGTTCCTGCGCCCCGAAG
GCGGCCTGGTGCGCAAGTTCGTCAAGGAGCAGCTCCTGGAGGACGTGGTGGCCACCGGACGCCGGTGGGA
GTTCACCTCGTCAGGCGGGGTCATGTACCGGCCTGACCTGCTCGGCTTCCTGGAGAAGACGGGCGCGCTC
TCCACCACGCTCTTCCCCGGCGGCGACACGGTGGACCCGCTGGTCCGCTTCCAGGTGCGCCTGCGCCCGG
GCGTCTCCGCGGACGGCATGGCTTCGCAGATTTCATCCATCACCCTGACGCTCGACGGGACGGACGAGAC
GTACCGCAACGGCCCGGACACGGTGTGGAAGCCGATGATCTGGCCCGGTCAGGCAGGCAAGCTCGGCGCC
CGCATCACCGTGCAGAGCGCGGATGGCTCCACGGAGACGACGCTGGAGGCCGAGGGTGACTGGGGCCTGT
TCCGCCTGCTGGAGCGCGTCAAGCGCATCGAGCCCAGCGCGGACGGCCGCTACTTCACCGCGACGTGGGA
AATCGAGGAGATGAACGGCGCGCTGGTCTCCATCGACTTCCGTCCGGAGCGCACCGCCAACCCGTTCTTC
GGGATGTCGGGCAACACGTCCAAGCTGCTGGCCATCTTCCGGGACCCGGGGTTGCAGCCGCCGACGACCA
TCGCTCGCAAAGGCGAGTGCGCGCCGCAGGCCATCGCGGCGGATAGGGTTCATTGA
 Primer design