SecReT6
Protein ID: 108761992
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4823
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6032464..6035913 [+]
ProductClpB family protein
NoteTssH
UniProt IDQ1D2Y9
KEGG IDmxa:MXAN_4823
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-32, Aligned region: 290..334
AAA_2 [PF07724], Evalue: 1.20E-32, Aligned region: 560..723
AAA [PF00004], Evalue: 2.20E-15, Aligned region: 289..386
AAA [PF00004], Evalue: 2.20E-15, Aligned region: 565..646
AAA_5 [PF07728], Evalue: 3.20E-15, Aligned region: 288..318
AAA_5 [PF07728], Evalue: 3.20E-15, Aligned region: 565..665
ClpB_D2-small [PF10431], Evalue: 5.30E-13, Aligned region: 735..802
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 269..423
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 535..589
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 621..648
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 870..924
AAA_17 [PF13207], Evalue: 8.50E-10, Aligned region: 289..313
AAA_17 [PF13207], Evalue: 8.50E-10, Aligned region: 565..601
AAA_17 [PF13207], Evalue: 8.50E-10, Aligned region: 877..937
AAA_33 [PF13671], Evalue: 4.30E-09, Aligned region: 289..411
AAA_33 [PF13671], Evalue: 4.30E-09, Aligned region: 564..587
AAA_18 [PF13238], Evalue: 2.80E-07, Aligned region: 289..310
AAA_18 [PF13238], Evalue: 2.80E-07, Aligned region: 567..594
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 285..321
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 563..586
IstB_IS21 [PF01695], Evalue: 1.30E-06, Aligned region: 274..309
IstB_IS21 [PF01695], Evalue: 1.30E-06, Aligned region: 565..584
DUF258 [PF03193], Evalue: 3.70E-06, Aligned region: 287..314
DUF258 [PF03193], Evalue: 3.70E-06, Aligned region: 564..583
AAA_23 [PF13476], Evalue: 3.70E-06, Aligned region: 289..310
AAA_23 [PF13476], Evalue: 3.70E-06, Aligned region: 563..606
AAA_23 [PF13476], Evalue: 3.70E-06, Aligned region: 882..948
Sigma54_activat [PF00158], Evalue: 5.60E-06, Aligned region: 280..309
Sigma54_activat [PF00158], Evalue: 5.60E-06, Aligned region: 560..661
AAA_29 [PF13555], Evalue: 5.70E-06, Aligned region: 288..314
AAA_29 [PF13555], Evalue: 5.70E-06, Aligned region: 563..590
AAA_28 [PF13521], Evalue: 8.80E-06, Aligned region: 289..320
AAA_28 [PF13521], Evalue: 8.80E-06, Aligned region: 566..585
ABC_tran [PF00005], Evalue: 1.30E-05, Aligned region: 282..311
ABC_tran [PF00005], Evalue: 1.30E-05, Aligned region: 565..586
MobB [PF03205], Evalue: 3.70E-05, Aligned region: 289..310
MobB [PF03205], Evalue: 3.70E-05, Aligned region: 564..594
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 288..326
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 565..586
RNA_helicase [PF00910], Evalue: 0.00015, Aligned region: 289..313
RNA_helicase [PF00910], Evalue: 0.00015, Aligned region: 566..587
AAA_14 [PF13173], Evalue: 0.00019, Aligned region: 287..311
AAA_14 [PF13173], Evalue: 0.00019, Aligned region: 564..647
AAA_19 [PF13245], Evalue: 0.00043, Aligned region: 283..312
AAA_19 [PF13245], Evalue: 0.00043, Aligned region: 565..589
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 283..313
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 548..585
AAA_30 [PF13604], Evalue: 0.00071, Aligned region: 281..312
AAA_30 [PF13604], Evalue: 0.00071, Aligned region: 564..589
Mg_chelatase [PF01078], Evalue: 0.00072, Aligned region: 281..318
Mg_chelatase [PF01078], Evalue: 0.00072, Aligned region: 565..589
AAA_25 [PF13481], Evalue: 0.00088, Aligned region: 288..311
AAA_25 [PF13481], Evalue: 0.00088, Aligned region: 557..583
SRP54 [PF00448], Evalue: 0.00094, Aligned region: 289..311
SRP54 [PF00448], Evalue: 0.00094, Aligned region: 564..590
AAA_3 [PF07726], Evalue: 0.00097, Aligned region: 289..312
AAA_3 [PF07726], Evalue: 0.00097, Aligned region: 568..676
Arch_ATPase [PF01637], Evalue: 0.0019, Aligned region: 280..314
Arch_ATPase [PF01637], Evalue: 0.0019, Aligned region: 564..586
Zeta_toxin [PF06414], Evalue: 0.0021, Aligned region: 289..311
Zeta_toxin [PF06414], Evalue: 0.0021, Aligned region: 560..600
AAA_10 [PF12846], Evalue: 0.0025, Aligned region: 290..311
AAA_10 [PF12846], Evalue: 0.0025, Aligned region: 565..603
AAA_10 [PF12846], Evalue: 0.0025, Aligned region: 835..923
Sigma54_activ_2 [PF14532], Evalue: 0.0038, Aligned region: 281..309
Sigma54_activ_2 [PF14532], Evalue: 0.0038, Aligned region: 548..584
T2SE [PF00437], Evalue: 0.0039, Aligned region: 272..312
T2SE [PF00437], Evalue: 0.0039, Aligned region: 562..595
UPF0079 [PF02367], Evalue: 0.004, Aligned region: 284..311
UPF0079 [PF02367], Evalue: 0.004, Aligned region: 564..591
MMR_HSR1 [PF01926], Evalue: 0.0065, Aligned region: 289..316
MMR_HSR1 [PF01926], Evalue: 0.0065, Aligned region: 566..583
Bac_DnaA [PF00308], Evalue: 0.0086, Aligned region: 282..311
Bac_DnaA [PF00308], Evalue: 0.0086, Aligned region: 565..585
PduV-EutP [PF10662], Evalue: 0.0092, Aligned region: 289..308
PduV-EutP [PF10662], Evalue: 0.0092, Aligned region: 565..584
Protein Sequence: 1149 a.a.     [Download]
>gi|108761992|ref|YP_632984.1| ClpB family protein [Myxococcus xanthus DK 1622]
MPSRTAPFSPESSPMNFRFQCWLQRHVSGRVTLTPLALRRLAVHADSLEAATEELTLALDDQLSRVHPRR
VPEFIAPTGGALETVELPAIPVWGAEENHFAPLTLSAVVAPTLNAFLGLHAPRLNSHHWFQSKTLPAEAS
ELLGDRLEGMSDAERLALRPDGPESLLEIEVRATPVALSELTPRELHRNIRPPPRPPDAPADLDDDTRED
GEDEDTEALDLDSWEPRRRTAHRGPGEPPAKPPPTPTLDSVGVAWHRLAQEGQLDAAYEQDALVALLRTR
LAAKDAEPVVLVGPSGVGKTSVLHALAQSLRAPTATEAERARPFYFLDGSRLIAGEGFFGDWQQQVLRAF
REATEARALLSLGHAVELLDAGKSAHSDQNVAQLLLPLLAARDVAVMAEATEETWAQVEQRNTSFARLFS
VVRVAEPTPDALGRIVAKVAEDDALAAAMQVQPDALDEARFLCRRFLPYGAQVGNTVAFVRRLLASCAQA
SRTSVTRLEATRQFASESGIPEHLLRDDQPLASAHVRDFLASRVMGQDAAVERAASVVSVLKAGMSDVRR
PLGVLLFVGPTGVGKTELSKALAELLFGAKERMVRLDMGEYAGPDALLRLMGDGETPGYLTSAVRRQPFC
VVLLDEVEKAHPAVHDALLGVLGEGRLTDASGRFTDFRNALIILTSNLGADTLRARVGFDASGGAPDMAS
LRAHYLSEVQRFFRPEMFNRMDDVVVFSPLSAPLLRRLVVRELEAVCRRPGLSLHDALLEVTPAAQDWLA
LRGFDARYGARPLKRALERELVVPVADWLAAHPRMGPANLTVDAGTTGLELRAESLGGAAEGGGREAIER
ILEEAATVRAEVQRWSRCAPMHSLRRVLAVFDKVSRHTAYWEERALAEENSRKSSEARALEQSLRECAQQ
AEAIEDLLFEAHLSRTVDQVESLSREVSQVKAAFARIRQRIYSSLFPPSHGATLYLVPGRGAWRQARMLA
AAYEGWAQKASMEKRRGLLAVPERKSGEKAHRTPPPPQWRWADDETFDKLVVQPVAYAIQVKGGPHALLL
AGEHGLHRFIEGSQISMVHAYFEPRPLSLFDLSSREALQKQLPKNEVRQVRLSGSGSGQGTLTDLRTGVQ
QRFGLEGPDLEPLLEPWMQWRVFNSRDED
 
Nucleotide Sequence: 3450 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6032464-6035913 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGCCGTCACGCACGGCACCGTTTTCACCCGAGTCCTCACCCATGAACTTCCGTTTTCAATGCTGGTTGC
AGCGGCACGTCAGCGGCCGGGTGACGCTCACGCCGCTGGCGCTGCGCCGTCTCGCGGTGCACGCGGACTC
GCTGGAGGCCGCCACCGAGGAGCTGACGCTCGCGCTGGACGACCAACTCTCCCGCGTCCACCCGCGGCGC
GTGCCGGAGTTCATCGCCCCCACCGGAGGGGCGCTCGAAACGGTGGAGCTACCCGCGATTCCCGTCTGGG
GCGCCGAGGAGAATCACTTCGCGCCGCTGACGTTGTCCGCCGTGGTGGCCCCCACGCTCAATGCCTTCCT
GGGCCTCCACGCGCCACGCCTCAACAGCCATCACTGGTTCCAGAGCAAGACACTCCCCGCCGAGGCCTCG
GAGCTGCTGGGAGATCGCCTGGAGGGAATGTCCGACGCGGAGCGCCTTGCCCTGCGTCCGGATGGACCTG
AGTCCCTGCTGGAAATCGAAGTGCGGGCCACCCCCGTGGCCCTGTCGGAGCTCACGCCTCGCGAGCTGCA
CCGGAACATTCGTCCACCGCCGCGCCCTCCAGACGCACCCGCCGACCTGGATGACGACACGCGCGAGGAC
GGCGAGGACGAAGACACGGAGGCGCTGGACCTGGACAGCTGGGAGCCACGCCGCCGCACCGCGCATCGAG
GCCCGGGTGAGCCGCCCGCGAAGCCGCCGCCTACGCCCACCCTGGACAGCGTCGGCGTGGCCTGGCACCG
GCTCGCGCAGGAAGGACAGCTCGACGCGGCCTACGAGCAGGATGCGCTCGTCGCCCTGCTCCGGACCCGG
CTCGCGGCCAAGGACGCCGAACCGGTGGTCCTGGTGGGGCCTTCGGGCGTGGGCAAGACGTCGGTGCTCC
ACGCGCTCGCCCAGTCGCTGCGCGCCCCCACCGCCACCGAGGCCGAGCGCGCCCGCCCGTTCTACTTCCT
CGACGGAAGCCGGCTCATCGCGGGCGAGGGCTTCTTCGGAGACTGGCAGCAGCAGGTGCTGCGCGCCTTC
CGTGAGGCCACCGAGGCCCGGGCCCTGCTGTCCCTGGGCCATGCCGTGGAGCTCCTCGACGCGGGCAAGA
GCGCCCACAGTGACCAGAACGTGGCCCAACTGCTGCTCCCGCTCCTCGCGGCGCGTGACGTGGCCGTCAT
GGCCGAGGCCACGGAGGAGACCTGGGCCCAGGTGGAGCAGCGCAACACCAGCTTCGCCCGGCTCTTCTCG
GTGGTGCGCGTCGCGGAGCCCACGCCCGATGCGCTCGGCCGCATCGTCGCCAAGGTGGCGGAGGACGACG
CCTTGGCCGCCGCGATGCAGGTCCAGCCCGACGCGCTCGACGAGGCGCGCTTCCTGTGCCGCCGCTTCCT
GCCCTACGGTGCCCAGGTGGGCAACACCGTGGCCTTCGTGCGCCGGCTGCTGGCGTCCTGTGCCCAAGCC
TCGCGCACCTCCGTCACCCGACTGGAGGCCACCCGCCAATTCGCCTCGGAGTCCGGCATCCCCGAGCACC
TGCTCCGGGACGACCAGCCGCTGGCGTCCGCACACGTGCGCGACTTCCTGGCCTCGCGAGTGATGGGGCA
GGACGCCGCCGTGGAGCGCGCAGCCTCGGTGGTATCCGTCCTCAAGGCCGGCATGTCGGACGTGCGGCGC
CCGCTGGGGGTGCTGCTCTTCGTGGGCCCCACCGGCGTGGGCAAGACGGAGCTGTCCAAGGCGCTGGCGG
AGCTACTCTTCGGTGCGAAGGAGCGCATGGTCCGCCTGGACATGGGTGAGTACGCCGGTCCGGACGCCCT
GCTGCGGTTGATGGGAGACGGGGAGACGCCGGGCTACCTCACCTCGGCGGTGCGCCGGCAGCCCTTCTGC
GTGGTGCTGCTGGACGAGGTGGAGAAGGCCCACCCCGCCGTTCACGATGCGCTGCTGGGCGTCTTGGGCG
AAGGCCGCCTCACCGATGCCTCCGGGCGCTTCACGGACTTCCGCAACGCCCTCATCATCCTCACCAGCAA
CCTGGGCGCGGACACCCTGCGCGCCCGCGTGGGCTTCGATGCGTCGGGCGGTGCCCCGGACATGGCCTCC
CTGCGCGCGCACTACCTCTCCGAGGTGCAGCGCTTCTTCCGGCCGGAGATGTTCAACCGCATGGACGACG
TGGTCGTCTTCTCGCCGCTGTCCGCCCCGCTGCTGCGCCGGTTGGTGGTCCGCGAGCTTGAAGCCGTATG
CCGCCGTCCAGGCCTCTCGCTCCACGATGCCCTGCTGGAGGTCACCCCCGCCGCCCAGGACTGGCTGGCC
CTGAGAGGCTTCGACGCGCGGTATGGTGCCCGCCCCTTGAAGCGCGCGCTGGAGCGCGAGCTGGTGGTCC
CCGTGGCGGACTGGCTCGCGGCGCATCCCCGCATGGGGCCGGCGAACCTCACGGTGGACGCGGGAACCAC
GGGACTCGAACTGCGCGCCGAGTCCCTGGGCGGCGCCGCCGAGGGCGGGGGCCGGGAAGCCATCGAGCGG
ATCCTCGAGGAAGCAGCCACCGTGCGCGCGGAAGTCCAGCGTTGGAGCCGCTGCGCGCCCATGCACTCCC
TGCGCCGCGTCCTGGCCGTCTTCGACAAGGTCTCCCGGCACACCGCGTACTGGGAGGAGCGGGCGCTGGC
CGAAGAAAACTCGCGCAAGTCATCGGAGGCGCGAGCGCTGGAACAGTCGCTTCGGGAGTGCGCCCAGCAG
GCGGAGGCCATCGAGGACCTGCTCTTCGAGGCCCACCTGTCCAGGACCGTGGATCAGGTGGAGTCCCTGA
GCCGCGAGGTGAGCCAGGTGAAGGCGGCCTTCGCGCGCATCCGGCAACGCATCTACTCCTCCCTCTTTCC
CCCGTCACATGGCGCGACCCTCTACCTGGTGCCAGGTCGCGGCGCGTGGAGGCAGGCACGCATGCTCGCC
GCGGCCTATGAGGGGTGGGCCCAGAAGGCGTCCATGGAGAAGCGGCGAGGCCTGCTCGCCGTCCCCGAGC
GCAAGTCCGGCGAGAAGGCCCATCGCACCCCTCCGCCGCCGCAATGGCGGTGGGCCGACGATGAGACCTT
CGACAAGCTCGTCGTGCAGCCGGTCGCCTATGCGATTCAGGTCAAGGGCGGCCCCCACGCCCTGCTGCTC
GCTGGCGAGCACGGCCTGCATCGCTTCATCGAAGGCAGTCAGATTTCGATGGTGCATGCGTACTTCGAGC
CGCGGCCCCTCTCGCTGTTCGACCTCTCCTCCCGGGAGGCGTTGCAGAAGCAGTTGCCGAAAAACGAGGT
CCGTCAGGTGCGCCTGTCGGGCAGCGGTTCCGGCCAGGGGACGCTGACGGACCTTCGCACCGGGGTGCAG
CAGCGCTTCGGTCTGGAGGGGCCTGACCTGGAGCCCCTGCTGGAGCCCTGGATGCAGTGGCGCGTCTTCA
ACAGCCGGGACGAGGACTGA
 Primer design