SecReT6
Protein ID: 108762488
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4800
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6004071..6006335 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDQ1D312
KEGG IDmxa:MXAN_4800
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-78, Aligned region: 34..335
Phage_base_V [PF04717], Evalue: 4.20E-26, Aligned region: 20..43
Phage_base_V [PF04717], Evalue: 4.20E-26, Aligned region: 377..470
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 516..530
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 520..538
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 559..581
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 583..605
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 619..638
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 650..670
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 673..680
Gp5_C [PF06715], Evalue: 6.30E-18, Aligned region: 717..726
Protein Sequence: 754 a.a.     [Download]
>gi|108762488|ref|YP_632961.1| Rhs element Vgr family protein [Myxococcus xanthus DK 1622]
MIANAALKANQAEFEFQAGPFTAGELAVLGFEAEETLSQPYAVEVALAARPDVDVDEKALLGQDARLTVM
LGDGTARFFHGIVSRMSRWDEGNGPERRRYRATVVPRLWTLRHRRKSRIYQEMTVPDIVHKVLDEAKVEH
RLALTGEYPKRDYCVQYRESDLDFVSRLLEEEGIFYFFEHGEDAHMMVIGDGASANPEMQGESKLVFRER
SQMVASQEYVHELVSRMEVQPGAVALRDYNFLRPAQDLGASSEAEDGEAALEIYDYPGRYEEPAPGRSLA
KVRLEELRARAETVTGASYSRRICVGHSFELAEHPDESANRKYLPVSVRHLGHQSEALSIEQGSLRSRED
YRNEFLCQPAEVPFRPPRVTPRPVIPGAQTAIVVGPSGEEIHTDEHGRIKVQFHWDREGKNNDKSSCWIR
VSQAWAGPGWGALYLPRIGHEVVVEFLEGDPDRPIVTGSVYNGANPTPIDLPGSKTQSTLRSSSSPGGAG
SNELRFEDAAGSELVYLHAQKDFNIVVENDKTQEVRGNETLLVRKDRSRVIEGNQALLVKKNDDSTVTGN
QTLAVTQNRSTTVGGNHTEAVAGDQSISVSGNQALTVAMASAETVALGKMLNVGGALAVTVGAAFNELVG
GLKSEQVGGAKVEVVGAKKSETVKGARTLQVGGDLSEEVGKSRTLKVDKDMLVSVAGKVNHAAKDAYTLS
AKEISLVAQEQFTLKVGSATLQVKKNGDVVIKGAKIEVTATGDVVIKGSKISEN
 
Nucleotide Sequence: 2265 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6004071-6006335 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGATCGCGAACGCCGCCTTGAAAGCCAACCAGGCTGAGTTCGAGTTCCAGGCAGGGCCCTTCACCGCCG
GAGAGCTGGCCGTCCTTGGCTTTGAAGCCGAGGAGACGCTGTCCCAGCCCTACGCGGTGGAGGTCGCACT
GGCCGCCCGGCCGGACGTGGACGTGGATGAGAAGGCGCTGCTGGGCCAGGACGCGCGGCTCACCGTCATG
CTCGGAGACGGCACCGCGCGCTTCTTCCACGGCATCGTGTCGCGCATGTCACGGTGGGATGAAGGCAATG
GCCCGGAGCGCCGCCGCTACCGCGCCACCGTGGTGCCGCGGCTGTGGACGCTGCGCCACCGCCGCAAGAG
CCGCATCTACCAGGAGATGACCGTCCCGGACATCGTCCACAAGGTGCTGGATGAAGCCAAGGTGGAGCAC
CGGCTGGCGCTCACCGGCGAGTACCCCAAGCGCGACTACTGCGTGCAGTACCGCGAGTCCGACCTCGACT
TCGTGTCCCGCCTCTTGGAGGAAGAAGGCATCTTCTACTTTTTCGAGCACGGCGAGGACGCCCACATGAT
GGTGATTGGCGACGGCGCCTCCGCCAATCCCGAGATGCAGGGCGAGTCCAAGCTTGTCTTCCGCGAGCGC
AGCCAGATGGTCGCCTCGCAGGAGTACGTCCACGAGCTGGTCTCCCGCATGGAGGTGCAGCCCGGCGCGG
TGGCCCTGCGCGACTACAACTTCCTGCGTCCCGCCCAGGACCTGGGTGCCAGCTCCGAGGCAGAGGACGG
CGAGGCCGCGCTCGAAATCTACGACTACCCCGGCCGCTATGAAGAGCCCGCGCCCGGCCGCAGCCTGGCG
AAGGTGCGCCTGGAGGAGCTGCGCGCGCGGGCGGAGACGGTGACGGGCGCCAGCTACAGCCGCCGCATCT
GCGTGGGCCACTCCTTCGAACTGGCGGAGCACCCGGACGAGTCCGCCAACCGCAAGTACCTGCCCGTCTC
CGTGCGGCACCTGGGCCACCAGTCGGAGGCGCTGAGCATCGAGCAGGGCTCGCTGCGCAGCCGGGAGGAC
TACCGCAACGAATTCCTCTGCCAGCCCGCGGAGGTGCCCTTCCGCCCGCCGCGCGTGACGCCGCGGCCGG
TGATTCCGGGCGCGCAGACGGCCATCGTGGTGGGCCCCAGCGGTGAGGAGATCCACACCGACGAGCACGG
CCGCATCAAGGTCCAGTTCCACTGGGACCGCGAGGGCAAGAACAACGACAAGAGCTCGTGCTGGATCCGC
GTCAGCCAGGCCTGGGCGGGCCCGGGCTGGGGCGCCCTGTACCTGCCGCGCATCGGCCATGAGGTCGTCG
TCGAGTTCCTCGAGGGCGACCCGGACCGGCCCATCGTCACCGGCAGCGTCTACAACGGGGCGAATCCGAC
GCCCATCGACCTGCCCGGCAGCAAGACGCAGAGCACGCTGCGCTCCAGCTCCAGCCCCGGCGGCGCGGGC
TCCAACGAGCTGCGCTTCGAGGACGCGGCCGGCAGCGAGCTCGTCTATCTGCACGCGCAGAAGGACTTCA
ACATCGTCGTGGAGAACGACAAGACGCAGGAGGTCCGCGGCAACGAGACGTTGCTGGTGCGCAAGGACCG
CTCCCGCGTCATCGAGGGCAACCAGGCCCTGCTGGTGAAGAAGAACGACGACAGCACCGTCACCGGCAAC
CAGACGCTGGCCGTCACGCAGAATCGCTCCACCACCGTGGGCGGCAACCACACCGAAGCGGTGGCCGGGG
ACCAGTCCATCAGCGTCAGCGGCAACCAGGCCCTCACGGTGGCCATGGCCTCCGCGGAGACGGTGGCCCT
GGGGAAGATGCTCAACGTGGGCGGCGCGCTCGCCGTCACCGTGGGCGCCGCCTTCAACGAACTGGTGGGC
GGCCTCAAGTCCGAACAGGTGGGCGGCGCCAAGGTGGAGGTCGTCGGCGCCAAGAAGTCCGAGACGGTCA
AGGGCGCCCGCACGCTCCAGGTCGGCGGGGACCTCTCCGAAGAGGTGGGTAAGTCCCGCACGCTCAAGGT
GGACAAGGACATGCTGGTCAGCGTGGCCGGCAAGGTGAACCACGCCGCCAAGGACGCCTACACACTGTCC
GCAAAGGAAATCTCACTGGTTGCCCAGGAGCAGTTCACCCTCAAGGTTGGCTCCGCCACGCTCCAGGTGA
AGAAGAACGGGGACGTGGTCATCAAGGGCGCCAAGATTGAGGTCACCGCGACGGGCGACGTCGTCATCAA
GGGCTCCAAGATTTCCGAGAACTAG
 Primer design