SecReT6
Protein ID: 108762493
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4803
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6008478..6009194 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ1D309
KEGG IDmxa:MXAN_4803
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-45, Aligned region: 4..205
TetR_C_6 [PF13977], Evalue: 0.0088, Aligned region: 31..70
Protein Sequence: 238 a.a.     [Download]
>gi|108762493|ref|YP_632964.1| hypothetical protein MXAN_4803 [Myxococcus xanthus DK 1622]
MDRVTEATKDCFDAAIQLRGSEASAVPPPETLHHRLRGVVDETLRRAAVLGFSHQDAQDMAYALVALIDE
VVLGRPEEYRQLWMPLQLHYFNENVAGDGFFARLNTVRKDPHRHEVLQVYYLCMLFGFQGRYRIRGGELE
LMTLIDTVQKDLERARPFDFDVLSPHGDRPTESLLSKRKKASMVSISAGALAVAVLFYGVLQFFLNDKVG
ELRSRIEVHAARNTATSASQTQATGGAQ
 
Nucleotide Sequence: 717 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6008478-6009194 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGACCGAGTCACCGAAGCCACGAAGGATTGTTTCGACGCCGCCATCCAACTGCGCGGCTCCGAAGCCT
CGGCGGTGCCCCCGCCCGAGACGCTGCACCACCGCCTTCGCGGCGTGGTGGACGAGACGCTGCGCCGCGC
CGCCGTGCTGGGCTTCAGCCATCAGGATGCCCAGGACATGGCCTACGCGCTCGTGGCGCTCATCGACGAG
GTCGTCCTGGGCCGCCCGGAGGAGTACCGACAGCTCTGGATGCCCCTCCAGCTCCACTACTTCAACGAGA
ACGTCGCTGGCGACGGCTTCTTCGCGCGCCTCAACACCGTGCGAAAGGACCCGCACCGGCACGAGGTGCT
GCAGGTCTACTATCTGTGCATGCTCTTCGGCTTCCAGGGCCGCTACCGCATCCGCGGCGGCGAGCTGGAG
CTGATGACGCTCATCGACACGGTGCAGAAGGACCTGGAGCGCGCGCGGCCCTTCGACTTCGACGTGCTGT
CGCCGCACGGGGACCGGCCCACCGAATCGCTGCTCTCCAAGCGCAAGAAGGCGTCAATGGTGAGCATCTC
CGCCGGGGCGCTCGCGGTGGCCGTCCTGTTCTACGGCGTGCTGCAGTTCTTCCTCAACGACAAGGTCGGT
GAGCTGAGAAGCCGCATCGAGGTCCACGCGGCCCGCAACACGGCGACGAGCGCCAGCCAGACGCAGGCAA
CGGGGGGGGCGCAGTGA
 Primer design