SecReT6
Protein ID: 108762514
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4810
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6018642..6019037 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ1D302
KEGG IDmxa:MXAN_4810
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.60E-23, Aligned region: 22..113
Protein Sequence: 131 a.a.     [Download]
>gi|108762514|ref|YP_632971.1| hypothetical protein MXAN_4810 [Myxococcus xanthus DK 1622]
MGSRGLLSRIAEGNGTLAPPGDVVESIAEHLRNLLNTRKGESVASPGYGILDLNDIVHSYPSAIPRMTQS
IRQAIQEFEPRLKSVVVHYNADPVDPTALRFDITAQLATRDRRGMVRFHTQVHPGGRVDLW
 
Nucleotide Sequence: 396 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6018642-6019037 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGGCTCCCGAGGCTTGTTGTCGCGCATCGCTGAAGGCAACGGCACGCTCGCCCCGCCTGGCGACGTCG
TTGAATCCATCGCCGAGCACCTGCGCAACCTCCTCAACACGCGCAAGGGAGAGTCCGTGGCCTCACCCGG
CTACGGCATCCTGGACCTGAACGACATCGTCCACTCCTACCCGTCGGCGATACCGCGGATGACGCAGTCC
ATCCGGCAGGCCATCCAGGAGTTCGAACCGCGCCTGAAGAGCGTGGTGGTGCACTACAACGCGGACCCGG
TGGACCCGACGGCGCTGCGCTTCGACATCACCGCCCAGTTGGCCACGCGGGATCGACGAGGCATGGTGCG
TTTCCATACCCAGGTGCACCCGGGCGGACGCGTGGACCTGTGGTGA
 Primer design