SecReT6
Protein ID: 108762846
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4809
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6018067..6018558 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ1D303
KEGG IDmxa:MXAN_4809
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.70E-31, Aligned region: 8..148
Protein Sequence: 163 a.a.     [Download]
>gi|108762846|ref|YP_632970.1| hypothetical protein MXAN_4809 [Myxococcus xanthus DK 1622]
MAESVHLYLKANGSDIKGDSTQTSLGRADSIECVAYSQKVFTAREAGSGLATGRRQYEGIEITKRIDKSS
PLLMKALCENQVIDATFKFFRPNPTGDGTTEQFYTVSIKKARINAIQQTVPNSFVPASTNLPPMETLQLV
FHTINWTITQGGVTHEDTWDTQR
 
Nucleotide Sequence: 492 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6018067-6018558 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGCTGAATCAGTACACCTGTACCTGAAGGCGAACGGCAGCGACATCAAGGGCGACAGCACGCAGACCA
GCCTGGGCCGCGCGGACTCCATCGAGTGCGTCGCGTACAGCCAGAAGGTCTTCACCGCTCGCGAGGCCGG
TTCGGGTCTGGCGACGGGCCGCCGCCAGTACGAGGGCATCGAAATCACCAAGCGCATCGACAAGTCGTCG
CCGCTGCTGATGAAGGCCCTCTGCGAGAACCAGGTCATCGACGCGACCTTCAAGTTCTTCCGTCCGAACC
CGACGGGCGACGGCACCACCGAGCAGTTCTACACGGTGTCCATCAAGAAGGCCCGCATCAACGCCATCCA
ACAGACGGTGCCGAACTCCTTCGTGCCGGCGAGCACCAACCTGCCCCCGATGGAGACCCTCCAGCTGGTG
TTCCACACCATCAACTGGACCATCACCCAGGGCGGCGTTACGCACGAGGACACCTGGGACACCCAGCGTT
GA
 Primer design