SecReT6
Protein ID: 108762900
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4812
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6020862..6021833 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ1D300
KEGG IDmxa:MXAN_4812
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-74, Aligned region: 2..310
Protein Sequence: 323 a.a.     [Download]
>gi|108762900|ref|YP_632973.1| hypothetical protein MXAN_4812 [Myxococcus xanthus DK 1622]
MGFFPLVAFLERLTSQATRVGGAGPVNEEMIRFRHDPSLGFPSGDVSSVTLHQVPVRAEDPYSKRPLFEV
VTRFLGLTGAVSPLPHYLAEEVAQEDPDHPVRREFLDLFHHRLLSLLYRIESKYRVTSETDTSFSDQWSR
RLLALGGFDTYEKALEGTLPTWRLLRIAPLLASRARTSEQLEVALEDVLGDDLEGARVSVRQFVGRWVDI
DARARLGHSNHQLGRNMLLGGKAFDRTGKIQIHIRPLPPRAYKRLMQEGDLLPLVREVVALFVRDPLEYD
LELGLTEGVQHQFRLSSREPSQLGRDTWLGLSQQTQMSVPVVK
 
Nucleotide Sequence: 972 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6020862-6021833 Myxococcus xanthus DK 1622 chromosome, complete genome
GTGGGCTTCTTTCCCCTGGTGGCGTTCTTGGAGCGGCTGACGTCGCAGGCCACGCGCGTGGGCGGCGCGG
GGCCCGTCAACGAGGAGATGATTCGCTTCCGGCACGACCCGTCCCTGGGGTTCCCCTCGGGCGACGTGTC
GTCCGTGACGCTCCACCAGGTGCCGGTGCGGGCGGAGGACCCGTATTCGAAGCGGCCGCTCTTCGAGGTG
GTGACACGCTTCCTGGGCCTGACGGGCGCGGTGAGTCCCCTGCCCCACTACCTGGCCGAGGAGGTCGCGC
AGGAGGACCCGGACCACCCGGTGCGGCGCGAGTTCCTGGACCTGTTCCACCACCGGCTGCTGTCGCTGCT
GTACCGCATCGAGTCGAAGTACCGCGTCACGAGCGAGACGGACACATCCTTCTCGGACCAGTGGTCCCGG
CGCCTGCTGGCGCTGGGCGGGTTCGACACCTACGAGAAGGCCCTGGAGGGTACGCTGCCGACCTGGCGCC
TGCTGCGGATTGCCCCGCTGCTGGCCAGCCGGGCGAGGACGTCCGAGCAGTTGGAGGTCGCGCTCGAGGA
CGTGCTGGGCGACGACCTGGAGGGCGCGCGGGTGTCGGTGCGCCAGTTCGTGGGCCGCTGGGTGGACATC
GACGCCCGGGCGCGGCTGGGCCACTCCAACCACCAACTGGGGCGCAACATGCTGCTGGGCGGCAAGGCCT
TCGACCGGACGGGGAAGATTCAAATCCACATCCGGCCGCTGCCGCCGCGCGCCTACAAGCGGCTGATGCA
GGAAGGGGACTTGCTGCCACTGGTGAGAGAAGTGGTAGCCCTCTTCGTGAGGGACCCCCTGGAGTACGAT
TTGGAGCTGGGGCTCACCGAAGGCGTGCAGCACCAGTTCCGGCTCTCCAGCCGGGAGCCGAGTCAGCTCG
GGCGGGACACGTGGCTGGGCCTGAGTCAGCAGACGCAGATGAGTGTCCCCGTGGTGAAATGA
 Primer design