SecReT6
Protein ID: 108763188
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4799
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6001993..6003840 [-]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDQ1D313, Q1D313
KEGG IDmxa:MXAN_4799
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.30E-17, Aligned region: 500..596
TSP_3 [PF02412], Evalue: 3.90E-14, Aligned region: 333..354
TSP_3 [PF02412], Evalue: 3.90E-14, Aligned region: 362..381
TSP_3 [PF02412], Evalue: 3.90E-14, Aligned region: 395..412
TSP_3 [PF02412], Evalue: 3.90E-14, Aligned region: 423..441
TSP_3 [PF02412], Evalue: 3.90E-14, Aligned region: 449..470
Protein Sequence: 615 a.a.     [Download]
>gi|108763188|ref|YP_632960.1| OmpA domain-containing protein [Myxococcus xanthus DK 1622]
MRRKELLHRGLALALALTSLSAGAQEAPVLRGFDLERLELNPGAEGSLLVGMGELLPVGAFRATVMMHYA
HQPLVYMDNLIREQPEVAIVSGRTTAHLAAAYAPLDWLQVGLQVPMVAFQGGDDVGMARYGIAVPASQAL
STPVVSARFGLLRQTEAGGVDLALDVAAGLPLGSEGAFARDDSGLRLSPRVMVGRHFGFIRAGLEVGYLQ
RPRVLLTDRTGETEDEVGQELRLGVALATTGKRLRWELNVRGMLPLTDQPTSVELLPGARYLVGSSLEMF
ALAGVGVGAAPGTPLFRLMVGGAFGNVTPPRGPGESSVRCEMGLPPEAKIQECPDMDEDGDGVRNADDKC
PLVPGDVARQGCSAQDTDGDGIEDMLDGCPLEHGPAARQGCPIPDQDGDEVPDEIDSCPSDPGPADNRGC
PVRDTDGDGIDNDKDECPNEAGPIERNGCPESDTDKDGVPNRADSCVNEPGDAKNLGCPLHILPLVEIRP
DRLVVMGKVFFEPTQARIQKRSYELLDWVARVIREHPEIPLVVVGAHTDDRGFPDDNRRLSQGRAEAVRQ
YLIGRDIAPERLKALGYGQERPIDSNATSNGRENNRRVEFLLADPQQDKSERGQR
 
Nucleotide Sequence: 1848 bp     [Download]
>gi|108756767|ref|NC_008095.1|:c6003840-6001993 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGAGAAGAAAAGAGCTCCTGCACCGCGGGCTCGCGCTGGCACTCGCGCTGACGTCGCTGTCCGCCGGGG
CGCAGGAAGCACCCGTGTTGCGAGGCTTCGACCTGGAGCGCCTGGAGCTGAATCCCGGCGCGGAGGGTTC
GCTCCTCGTCGGCATGGGCGAACTGCTTCCCGTGGGGGCGTTCCGCGCGACGGTGATGATGCACTACGCA
CATCAGCCGCTCGTCTACATGGACAACCTCATTCGCGAGCAGCCCGAGGTGGCCATCGTCTCTGGACGCA
CCACGGCGCATCTGGCTGCCGCGTATGCCCCGTTGGACTGGCTCCAGGTGGGCCTGCAGGTTCCCATGGT
GGCGTTCCAGGGCGGCGATGACGTTGGCATGGCGCGTTATGGGATTGCCGTGCCCGCCAGTCAGGCGCTG
TCCACGCCGGTGGTGAGCGCGCGCTTCGGCTTGCTGAGGCAGACGGAAGCGGGTGGGGTGGACCTGGCCC
TGGATGTGGCGGCGGGGCTGCCGCTGGGCAGCGAGGGGGCCTTTGCCCGCGATGATAGCGGGCTCCGCTT
GTCGCCGCGGGTGATGGTGGGACGGCACTTCGGCTTCATCCGCGCGGGCCTGGAGGTTGGCTATCTGCAG
CGCCCGCGCGTGCTGCTGACGGACCGCACGGGCGAAACCGAGGATGAGGTGGGCCAGGAGCTGCGCCTGG
GCGTGGCGTTGGCCACGACGGGCAAGCGGTTGCGCTGGGAGCTCAACGTCCGGGGCATGCTGCCGCTGAC
GGATCAGCCGACCTCGGTGGAGTTGCTTCCTGGCGCTCGCTACCTGGTGGGCTCGTCGCTGGAGATGTTC
GCGCTGGCGGGCGTGGGCGTGGGCGCGGCGCCCGGCACGCCGCTGTTCCGGCTGATGGTGGGCGGGGCTT
TCGGCAACGTGACGCCGCCGCGGGGCCCGGGTGAGTCCTCGGTCCGGTGTGAGATGGGGCTGCCGCCCGA
GGCGAAGATTCAAGAGTGCCCGGACATGGACGAGGACGGCGACGGCGTGCGTAACGCCGACGACAAGTGC
CCGCTGGTGCCGGGAGACGTGGCGCGCCAGGGGTGCTCGGCTCAGGACACGGACGGCGACGGAATCGAAG
ACATGTTGGACGGCTGCCCGCTGGAGCACGGTCCCGCCGCGCGCCAGGGCTGCCCGATTCCGGACCAGGA
CGGTGACGAGGTCCCCGACGAAATCGACAGTTGCCCGTCGGACCCGGGGCCCGCGGACAACCGGGGCTGC
CCGGTGCGGGACACCGACGGCGACGGCATCGACAACGACAAGGACGAGTGCCCGAACGAGGCCGGTCCCA
TCGAGCGCAATGGCTGCCCGGAGTCGGACACGGACAAGGATGGCGTGCCCAACCGCGCGGACAGCTGTGT
GAATGAGCCGGGGGACGCCAAGAACCTGGGCTGCCCGCTGCACATCCTGCCGCTGGTGGAGATTCGTCCG
GACCGCCTGGTGGTGATGGGCAAGGTCTTCTTCGAGCCGACGCAGGCACGCATCCAGAAGCGCTCCTATG
AATTGCTGGATTGGGTGGCGCGCGTCATCCGAGAGCACCCGGAGATTCCGCTCGTCGTGGTGGGCGCGCA
CACGGACGACCGGGGCTTCCCGGACGACAACCGCCGCCTGTCGCAGGGGCGTGCGGAGGCCGTGCGCCAG
TACCTCATCGGCCGGGATATCGCGCCCGAGCGGCTGAAGGCCCTGGGCTACGGTCAGGAGCGCCCCATCG
ACAGCAACGCGACGTCGAACGGCCGTGAGAACAACCGCCGCGTGGAGTTCCTGCTGGCGGACCCACAGCA
AGACAAGTCCGAGCGCGGTCAGCGCTGA
 Primer design