SecReT6
Protein ID: 108763265
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4802
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6007095..6008462 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ1D310
KEGG IDmxa:MXAN_4802
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-120, Aligned region: 19..450
Protein Sequence: 455 a.a.     [Download]
>gi|108763265|ref|YP_632963.1| hypothetical protein MXAN_4802 [Myxococcus xanthus DK 1622]
MKSVQRVVWSEGMFMSPHHLQQQDLYHEQLLDQRLASLEPYPWGVVALEFDMEALRAGQVQLTHFTGILP
DGLPVSFESGDAEAPPARPADGYFPPAQRTLDVYLGVPRERSGVESFGSGERLGSSPRYTPASRPVSDLT
ASTSISQVAFGQRNVRLLFGTEPRDDFESIKLCELSRDRSGNLMLVESFIPPCLRIDASPFVMNELRTML
RLMVSKQRQLSSRRRHRDASALEFTAGDVTLFLELNALNGTIPFIQHALDAGNLRPRDLYLALAQCAGQL
CTFSVSADPSTLPTFQFTNLRATFEELFRRLSELMRAVALEQCLSVDLTAGADGMFRGRLEDDRLERCGH
FILAVRSELPERVVAEQLPKLSKVAAWEDIRALVQAAAPGVPLAVTYRPPPEVPVQPGTVYFSLSMNDGY
WRNVMRDRNLAIYLPQPFDANRTTVELLAVPTANR
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6007095-6008462 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGAAGTCCGTGCAGCGAGTCGTCTGGTCGGAGGGCATGTTCATGAGCCCCCACCACCTCCAGCAGCAGG
ACCTCTACCACGAGCAACTGCTGGATCAGCGGCTGGCCTCGCTCGAACCGTATCCCTGGGGCGTCGTGGC
CCTGGAGTTCGACATGGAGGCGCTGCGCGCCGGCCAGGTGCAGCTGACCCACTTCACCGGCATCCTCCCC
GACGGGCTGCCGGTCTCCTTCGAGTCCGGAGACGCGGAGGCGCCGCCCGCTCGGCCCGCGGATGGCTACT
TCCCGCCCGCCCAGCGCACCCTGGACGTGTACCTGGGCGTGCCGCGCGAACGCAGCGGCGTGGAGAGCTT
CGGCAGCGGGGAGCGGCTGGGCAGCAGCCCGCGCTACACCCCCGCCTCCCGCCCCGTCAGTGATTTGACG
GCCTCCACCTCCATCTCGCAGGTGGCCTTCGGTCAGCGCAACGTGCGCCTGCTGTTCGGCACCGAGCCGC
GCGACGACTTCGAGTCCATCAAGCTGTGCGAGCTGTCCCGCGACCGCTCCGGCAACCTGATGCTGGTGGA
GTCCTTCATCCCGCCGTGCCTGCGCATCGACGCGTCCCCGTTCGTCATGAACGAGCTGCGGACGATGTTG
CGGCTGATGGTGTCCAAGCAGCGGCAGTTGTCCTCGCGGCGGCGGCACCGGGACGCCTCGGCGCTGGAGT
TCACCGCGGGCGACGTGACGCTCTTCCTGGAGCTCAACGCGCTCAACGGCACCATCCCCTTCATCCAGCA
CGCGCTGGACGCGGGCAACCTGCGGCCCAGGGACTTGTACCTGGCGCTGGCGCAGTGCGCGGGGCAATTG
TGCACCTTCTCCGTCAGCGCGGACCCGTCCACGCTGCCCACCTTCCAGTTCACCAACCTGCGCGCCACCT
TCGAGGAGCTGTTCCGCCGCCTCTCCGAGCTGATGCGCGCGGTGGCGCTGGAGCAGTGCCTGTCGGTGGA
CCTGACGGCGGGCGCAGACGGCATGTTCCGCGGCCGGCTGGAGGACGACCGGCTGGAGCGCTGCGGCCAC
TTCATCCTCGCGGTGCGCAGCGAGCTGCCGGAGCGGGTGGTGGCCGAGCAGCTCCCCAAGCTGTCGAAGG
TGGCCGCCTGGGAGGACATCCGCGCGCTGGTGCAGGCCGCCGCGCCCGGCGTGCCGCTGGCGGTGACGTA
CCGGCCACCGCCCGAAGTCCCCGTGCAGCCAGGCACCGTCTACTTCAGCCTCTCCATGAATGACGGCTAC
TGGAGGAACGTGATGCGGGACCGCAACCTCGCCATCTACCTCCCGCAGCCGTTCGACGCGAACCGAACGA
CCGTGGAACTGCTCGCGGTTCCCACCGCCAATCGCTGA
 Primer design