SecReT6
Protein ID: 108763725
SecReT6 ID127
T6SS typei1
Gene symbol-
Locus tagMXAN_4808
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6016463..6017947 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ1D304
KEGG IDmxa:MXAN_4808
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-185, Aligned region: 67..492
Protein Sequence: 494 a.a.     [Download]
>gi|108763725|ref|YP_632969.1| hypothetical protein MXAN_4808 [Myxococcus xanthus DK 1622]
MANETQTQKSTGVANDASLSLLDEILSEAKLKPKDEGYDVAKRGVQAFITEMLAPNRSEERVDKALVDAM
IAEIDKRLSSQVNEILHAKEFQKLESSWRSLKFMVDRTDFRENTRVEMLNASKEDLQKDFEDAPEVTKSG
LYKLVYSNEYGVFGGKPYGIISANYDFNVGPQDMELLRKCASVAAMAHAPFIGNAAPEVFGEESFLKLPD
LKDLKSLFEGPQYARWHSFRESEDARYVGLALPRFLLRLPYGEKTVPVKAFNFTEDVVGHHERYLWGHAS
VALTSRVADSFAKFRWSPNIIGPQSGGAVENLPLHQYEAMGEIQTKIPTEVMLTERREFELSEEGFIGLV
FRKDSDNAAFFSANSTQKPRFFGNTPEGKAAETNYRLGTQLPYMFIMTRLAHYIKVLQREQIGSWKEKSD
LERELNHWLSQYISDMDDPAPAVRSRRPLRAARVVVEDVEGQPGWYRCSLQVRPHFKYMGASFTLSLVGK
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|108756767|ref|NC_008095.1|:6016463-6017947 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGCCAACGAGACCCAGACCCAGAAGTCCACGGGCGTCGCCAATGACGCCTCGCTGTCCCTGCTCGACG
AAATCCTGTCCGAGGCCAAGCTGAAGCCGAAGGACGAGGGTTACGACGTCGCCAAGCGCGGCGTGCAGGC
CTTCATCACCGAGATGCTGGCGCCCAACCGCTCCGAGGAGCGCGTGGACAAGGCGCTCGTCGACGCGATG
ATTGCCGAAATCGACAAGCGCCTGTCCTCCCAGGTCAACGAAATCCTCCACGCGAAGGAGTTCCAGAAGC
TGGAGTCCTCGTGGCGCTCGCTGAAGTTCATGGTGGACCGCACCGACTTCCGCGAGAACACCCGCGTGGA
GATGCTGAACGCCTCCAAGGAAGACCTGCAGAAGGACTTCGAGGACGCGCCCGAGGTCACCAAGAGCGGC
CTGTACAAGCTCGTGTACTCCAACGAGTACGGCGTCTTCGGTGGCAAGCCCTACGGCATCATCTCCGCCA
ACTACGACTTCAACGTGGGCCCGCAGGACATGGAGCTGCTCCGCAAGTGCGCCTCCGTGGCCGCCATGGC
GCACGCGCCCTTCATCGGCAATGCCGCGCCGGAAGTGTTCGGCGAGGAGAGCTTCCTCAAGCTGCCCGAC
CTGAAGGACCTCAAGTCGCTCTTCGAGGGTCCGCAGTACGCCCGGTGGCACTCGTTCCGTGAGAGCGAGG
ACGCGCGCTACGTGGGCCTGGCGCTGCCGCGCTTCCTGCTGCGCCTGCCCTACGGTGAGAAGACGGTGCC
GGTGAAGGCCTTCAACTTCACCGAAGACGTCGTGGGCCACCACGAGCGCTACCTGTGGGGTCACGCCTCC
GTGGCGCTCACCAGCCGCGTGGCGGACTCGTTCGCCAAGTTCCGCTGGAGCCCGAACATCATCGGTCCCC
AGTCCGGCGGCGCGGTGGAGAACCTGCCGCTGCACCAGTACGAGGCCATGGGGGAGATCCAGACCAAGAT
TCCCACCGAGGTCATGCTCACCGAGCGGCGCGAGTTCGAGCTCTCCGAGGAGGGCTTCATCGGCCTGGTG
TTCCGCAAGGACTCCGACAACGCGGCCTTCTTCAGCGCCAACTCCACGCAGAAGCCCCGGTTCTTCGGCA
ACACCCCGGAGGGCAAGGCGGCGGAGACCAACTATCGCCTGGGCACGCAGCTCCCTTACATGTTCATCAT
GACCCGCCTGGCGCACTACATCAAAGTGCTCCAGCGCGAGCAGATTGGTAGCTGGAAGGAGAAGTCGGAC
CTGGAGCGCGAGCTCAATCACTGGCTCAGCCAGTACATCTCCGACATGGACGACCCTGCTCCCGCCGTGC
GCTCGCGCCGCCCCCTGCGCGCCGCGCGCGTGGTGGTGGAGGACGTGGAGGGTCAGCCGGGCTGGTACCG
CTGCAGCCTGCAGGTGCGCCCCCACTTCAAGTACATGGGTGCATCGTTCACCTTGTCCCTCGTGGGCAAG
CTGGACAAGGAGTAG
 Primer design