SecReT6
Protein ID: 108806773
SecReT6 ID137
T6SS typei2
Gene symbol-
Locus tagYPA_0776
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]891746..895168 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ1C9X8
KEGG IDypa:YPA_0776
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.70E-75, Aligned region: 84..122
IcmF-related [PF06761], Evalue: 3.70E-75, Aligned region: 418..736
IcmF-related [PF06761], Evalue: 3.70E-75, Aligned region: 1053..1096
DUF1215 [PF06744], Evalue: 2.30E-38, Aligned region: 859..980
Bacillus_PapR [PF05968], Evalue: 0.0061, Aligned region: 371..409
Protein Sequence: 1140 a.a.     [Download]
>gi|108806773|ref|YP_650689.1| hypothetical protein YPA_0776 [Yersinia pestis Antiqua]
MKRIALPIKKPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIPGTPQRDRWLTGLVVGTGILTLCALLS
YAGTRLSGRKHFDELRQQAQGDDAPLPEDNAQAGETQQGEPSRLKTRLRRRYGLFWRDKVRLLMVVGEPD
EIAALAPQLAEQGWLEGQRTVLIHGGSLQRPADETGLSEWRKLRRGRPLDGIVWAMTAAQSGTPQWMDNG
LRTLEKMGAALRYQPPVYLWQVCDSDWPQDSRTEQPVGAVFPAKATPEKVEQQLRALLPQLREQGMQQLS
IEPHHDFLLRLAQSLDQGDAARWRQRLTPWFTEYAARIPLRGLMFSLPDTSASAAQVHEKSWTVPASWQG
VLDDCRGARGRRVGLPWEQTLCYSLLALIVLWGVGSVVSFAVNRHQMVSAAQQAQQLAQSHAVSDQQLMA
LQALRNDIGRLQSRVAQGAPWYQRFGLDHNAPLLEVLMPWYGQANNRILRDATAQSLYQKLSELAELPAN
SPQRAARAKTGYDQLKAYLMMARPEKADAVFYAQVMQTTEPTRAGVSPGLWQSLAPDLWQFYAQNLPAQP
DWKITPDTGLISQVRQVLLGQMGQRNAESTLYENMLLSVRRNYADMTLMDMTGDTDAQRLFQTSESVPGM
FTRKAWDEQIQQAIDKTVASRREEIDWVLSDNRRAISEDISPEALKKRLTERYFTDFAGSWLSFLNSLHW
NEAHNLSDVIDQLTLMSDVRQSPLIALMNTLAWQGQTGQQNQALSDSLVKSAKALMNKDQAPAIDQSAGG
PVGPLDETFGPLLALMGKGDAQNRLSSDSSLSLQTLLTRVTRVRLKLQQVVNASDPQEMTQVLAQTVFQG
KSVDLTDTQEYGSLIAASLGEEWSSFGQTMFVQPLTQAWETVLQPSSASLNDQWKNAVVANWKSAFDGRY
PFAASKSDASLPMLAEFIRKDSGRIDSFLTRELGGVLHKEGTRWVPNKVNSQGLTFNPAFLAAINQLSQI
SDILFTDGSQGLRFELLARPVPNVVETNLAIDGQKLHYFNQMESWQSFRWPGETYKPGTMLTWTGVSSGA
RLYGDYQGTWGLIRWLEQAKQKKLDEGRYQLTFTTADKQPLQWILRTELGKGPLGLLQLRNFTLPAQIFL
IQHAPLAIADMSDDEDMAED
 
Nucleotide Sequence: 3423 bp     [Download]
>gi|108805998|ref|NC_008150.1|:891746-895168 Yersinia pestis Antiqua chromosome, complete genome
GTGAAGCGCATTGCCTTACCGATTAAAAAGCCAGAAGTCTGGTTCTGGATTGTTGCCCTGCTGTTTTTGC
TGGCCGGTGCCGTGTTGTGCTGGCTGGTCTGGCAACACCCCGAACGGGTGGGGTTAATTCCGGGGACACC
GCAACGTGACCGTTGGCTGACGGGACTGGTGGTGGGAACGGGGATCCTGACCCTGTGCGCATTACTGTCG
TATGCGGGGACCCGGTTATCCGGCAGAAAACACTTTGATGAGCTACGGCAGCAGGCACAGGGCGATGATG
CGCCGTTGCCGGAAGACAACGCGCAGGCGGGTGAGACTCAGCAGGGTGAACCGTCCCGCCTAAAAACCCG
CCTGCGCCGCCGTTACGGTCTGTTCTGGCGCGACAAAGTCCGGCTGCTGATGGTGGTGGGTGAACCTGAC
GAAATCGCCGCGCTGGCCCCGCAACTGGCGGAGCAGGGCTGGCTGGAAGGGCAGCGCACGGTGTTGATAC
ACGGTGGCAGTTTACAACGTCCGGCGGATGAAACCGGGCTGAGTGAGTGGCGCAAACTGCGCCGTGGCCG
CCCGTTGGATGGCATTGTCTGGGCGATGACCGCCGCGCAGAGTGGCACGCCACAGTGGATGGATAACGGC
CTGCGAACGCTGGAAAAAATGGGTGCCGCCTTGCGCTATCAACCGCCGGTGTATCTGTGGCAGGTCTGTG
ACAGCGACTGGCCTCAGGATTCGCGGACGGAGCAGCCGGTCGGGGCGGTGTTCCCGGCGAAGGCTACGCC
AGAAAAGGTGGAGCAGCAACTGCGTGCCCTGTTGCCTCAGTTACGTGAACAGGGAATGCAGCAGCTTTCC
ATCGAGCCGCACCATGATTTCTTGTTGCGTCTGGCGCAGTCACTGGATCAGGGCGATGCGGCTCGCTGGC
GGCAGCGTCTGACGCCGTGGTTTACCGAGTATGCCGCGCGTATTCCCTTGCGTGGGCTGATGTTCAGTTT
ACCCGATACCTCTGCATCGGCGGCGCAGGTACATGAGAAAAGCTGGACGGTACCGGCCAGTTGGCAGGGG
GTACTGGATGATTGCCGGGGGGCGCGTGGACGCCGTGTCGGGCTGCCGTGGGAGCAGACACTGTGCTACA
GCTTGCTGGCACTGATTGTCTTGTGGGGTGTGGGCAGCGTGGTGTCATTTGCGGTCAACCGCCACCAGAT
GGTCTCTGCCGCACAACAAGCACAGCAACTGGCGCAGTCGCACGCGGTCTCCGACCAGCAACTGATGGCC
CTACAAGCCCTGCGAAATGATATCGGGCGCTTACAATCTCGCGTGGCGCAGGGCGCGCCGTGGTATCAGC
GCTTTGGTCTGGACCATAATGCGCCGCTGCTTGAGGTCCTGATGCCGTGGTATGGTCAGGCCAACAACCG
TATTCTCAGGGATGCCACCGCGCAGAGCCTGTATCAGAAACTCAGCGAACTGGCGGAGCTGCCCGCCAAC
AGCCCGCAACGGGCAGCACGGGCAAAAACAGGCTATGACCAGTTAAAGGCTTATCTGATGATGGCCCGCC
CGGAAAAAGCCGATGCTGTATTTTATGCTCAGGTGATGCAGACCACCGAGCCTACACGGGCCGGTGTCTC
CCCCGGTCTGTGGCAGAGTCTGGCGCCCGACTTGTGGCAGTTTTATGCACAAAATCTGCCCGCTCAGCCG
GACTGGAAAATTACCCCGGATACCGGGTTGATCAGCCAGGTGCGGCAGGTGTTGCTGGGGCAGATGGGTC
AGCGCAATGCAGAAAGTACGCTGTATGAAAACATGCTGCTGTCGGTGCGCCGCAACTATGCCGACATGAC
GCTGATGGACATGACCGGCGATACCGATGCTCAGCGTCTGTTTCAGACCTCGGAATCCGTGCCCGGTATG
TTCACCCGCAAGGCCTGGGATGAGCAAATCCAGCAGGCGATAGATAAAACGGTGGCCTCCCGCCGCGAAG
AAATTGACTGGGTATTGAGTGATAACCGCCGGGCGATATCCGAAGATATCTCACCGGAAGCGCTGAAAAA
ACGCCTGACCGAACGTTATTTCACCGATTTTGCTGGCAGTTGGCTGAGTTTCCTCAACAGTTTGCACTGG
AATGAGGCGCATAACCTGTCGGATGTGATTGACCAACTGACCTTGATGAGTGATGTACGCCAGTCGCCGC
TGATTGCGCTAATGAACACGCTGGCGTGGCAAGGGCAGACCGGGCAGCAGAATCAGGCATTATCGGATTC
GCTGGTGAAGTCTGCCAAGGCGCTGATGAATAAAGACCAGGCTCCGGCGATTGACCAGAGTGCCGGTGGG
CCAGTAGGGCCACTGGACGAGACCTTTGGCCCGTTGCTGGCACTGATGGGCAAAGGCGATGCACAAAACA
GGCTGTCGTCGGACAGCTCGCTGAGCCTGCAAACGTTGCTCACCCGCGTGACCCGGGTGCGGCTTAAACT
CCAGCAGGTGGTCAATGCTTCGGATCCGCAGGAGATGACACAGGTGCTGGCCCAGACCGTTTTCCAGGGC
AAAAGTGTTGATCTGACGGACACGCAGGAGTACGGCAGCCTGATAGCCGCCAGTCTGGGAGAGGAGTGGA
GCAGCTTCGGGCAGACGATGTTTGTTCAGCCGCTGACGCAGGCGTGGGAAACCGTGCTGCAACCTTCATC
GGCCAGTCTCAACGACCAGTGGAAAAACGCGGTGGTGGCCAACTGGAAATCGGCCTTTGATGGCCGCTAT
CCGTTTGCCGCCAGTAAAAGTGATGCTTCATTGCCGATGCTGGCCGAGTTTATCCGCAAGGACAGCGGGC
GCATCGACAGCTTCCTGACCCGTGAACTGGGCGGCGTGCTGCACAAAGAAGGAACGCGCTGGGTGCCGAA
TAAGGTGAACAGCCAGGGGCTGACCTTTAACCCGGCCTTCCTGGCGGCGATTAATCAACTGAGCCAAATC
TCCGACATCTTGTTCACTGACGGCAGTCAGGGGCTACGCTTTGAGCTGCTGGCCCGTCCGGTGCCGAATG
TGGTGGAAACGAATCTGGCGATTGACGGACAGAAATTGCATTATTTCAACCAGATGGAGAGCTGGCAGAG
TTTCCGCTGGCCGGGGGAGACCTATAAACCCGGCACGATGTTGACCTGGACTGGTGTGAGTTCAGGCGCC
CGGTTGTACGGTGATTATCAGGGGACATGGGGGCTGATCCGTTGGCTGGAGCAGGCAAAACAGAAAAAGC
TGGATGAAGGGCGCTATCAACTGACCTTCACCACCGCAGATAAACAGCCATTGCAATGGATATTACGCAC
CGAGCTGGGCAAAGGCCCGTTAGGCCTGTTGCAACTGCGTAATTTCACTCTGCCTGCGCAAATTTTTCTG
ATACAGCACGCGCCGCTTGCGATTGCTGACATGTCAGACGATGAAGACATGGCAGAAGACTGA
 Primer design