SecReT6
Protein ID: 108809397
SecReT6 ID139
T6SS typeN/A
Gene symbol-
Locus tagYPA_3406
StrainYersinia pestis Antiqua
Repliconchromosome [GenBank: NC_008150] [Browse all T6SS(s) in this replicon]
Location [Strand]3799255..3802788 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ1C2F4
KEGG IDypa:YPA_3406
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.00E-89, Aligned region: 507..822
ImcF-related_N [PF14331], Evalue: 1.40E-69, Aligned region: 201..455
DUF1215 [PF06744], Evalue: 4.80E-39, Aligned region: 309..323
DUF1215 [PF06744], Evalue: 4.80E-39, Aligned region: 916..1035
DUF4131 [PF13567], Evalue: 0.0007, Aligned region: 15..93
DUF4131 [PF13567], Evalue: 0.0007, Aligned region: 444..477
MMR_HSR1 [PF01926], Evalue: 0.0028, Aligned region: 133..273
Protein Sequence: 1177 a.a.     [Download]
>gi|108809397|ref|YP_653313.1| hypothetical protein YPA_3406 [Yersinia pestis Antiqua]
MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQLGENYPFETLLSRWLVTAVFVLVAVC
WLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQQNHYLNGWKHQLQRHLNTPEYLYRLPWYMVIGARNS
GKSTLIKEGYKLTEISASERLHAEDAADLRVRCWLGEQAVIIDPAGVLIEQPTTPIAGKASLNSRLWQSL
LSWLIEQRQRQPLNGIILTVDLHQMMTANKAQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGF
EAMYQSLDKAEREAVLGVTFSLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAGQRSQLFSFTR
QMQGLHDYVVQLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSAAVQYHLAPQAFPTWPVSDTTP
YFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGVGALAALTLWGYWHYYHQLNYRAGEEVLTQAKT
FLSIPPPEGDDRYGNLQLPLLNPIRDATLAYGNYHERSPFLADMGLYQGNNIGPYVESTYLQLLQQRFVP
ALMSGLLEQLNAAPKGSEEKLEILRVMRMLEDGSGRNAALVEQYMSHRWSQQFNGQRELQEQLSSHLNYA
LKHTDWHGARESGDQYAIKSFVPYLRPIQSAQQELSKLSIYQRVYQNLRIKAQDALPPALDLRDQIGASF
DDIFVSGNDRLLVIPQFLTRSGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEYSEADRKEIHRQVTEQYL
GDYTATWRAAMNNLSVSDFEGLPQAISAIEQVISGEQPFRRALQTLSDNTRLPVISDLIPAKEQQELLQK
PDYLLLTRINREFSPETAVLVENGDKGSVIQSVYQKLTELHRYLLAIQNSPAPGKAALKAVQLRLDQNNS
DPIFEVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAIQSLEVEWNETVIKQYQTYLAGRYPFDPHAKQDV
PLSEFERFFGPKGTLDAFYQQNLKPFVENNLTGGSDGELLIRPDVLQQLAQARKIRDTFFSAQNGLGTQF
AIEPVLLSGNKRRSVLNLDGQLLDYAHGRSGVVHLVWPNSMRAGVESKLTLVPDESGKSPRTLSFSGPWA
QLRLINAGELTNVGTNSFDVRFKVDGGEMTYRIFVDESDNPFAGGLFSKFSLPDTLY
 
Nucleotide Sequence: 3534 bp     [Download]
>gi|108805998|ref|NC_008150.1|:3799255-3802788 Yersinia pestis Antiqua chromosome, complete genome
ATGAAATTGCCGTTCTTTATACGCATAGCCAAGCCCGCCATTCCTCGCCTTAAAGCGTCAATACCGGTGG
TATTGGCGTTGATGGCTTGTGCGGCACTCATTTGGGTATGGATTTACGGACCCGAGTGGCAATTGGGGGA
AAATTACCCGTTTGAGACATTATTGAGCCGTTGGTTGGTCACGGCGGTATTTGTCTTGGTGGCCGTTTGT
TGGCTCAGCCTGAAAGTCATGAGGCGAGTACAACACCTGGAAAAACTCCAACTGCAAACGAAAATTCAGC
TCGACGACCCCGTCAGTGCTGATATCGAGCAACAAAACCACTACCTCAATGGCTGGAAGCACCAACTTCA
GCGCCATTTGAACACCCCGGAATATCTGTATCGCCTGCCCTGGTACATGGTCATTGGTGCGCGCAATAGC
GGCAAAAGTACACTGATCAAAGAAGGGTATAAACTGACAGAGATCTCCGCATCCGAGCGGCTCCATGCGG
AAGACGCAGCAGATCTGCGCGTCCGCTGCTGGTTGGGGGAACAAGCGGTTATTATCGATCCTGCGGGGGT
GCTGATTGAACAACCTACGACACCGATCGCGGGCAAAGCATCACTCAACAGCCGCTTATGGCAAAGTCTA
TTATCCTGGCTGATTGAACAGCGCCAGCGTCAGCCGCTAAACGGCATTATTCTCACCGTCGATCTTCATC
AGATGATGACCGCGAATAAAGCGCAGCGGGAGACTTACGTCGCTGATATTCATCAACGGCTGCAAGAGAT
ACGGCTGTCTTTGCACAGCCAGGTGCCGCTGTATGTGGTGTTCACCAAAATGGACCTGCTGTACGGCTTC
GAGGCCATGTACCAATCGCTGGATAAAGCCGAACGTGAAGCGGTTCTGGGGGTGACGTTCAGCCTCAATG
CGGCGGATCCGGACGTGTGGCGGACGGAGTTGAAACAGTTCTGGCAGCAATGGGTCGCACAACTGAATGG
CGCGATGCCGGACATGATGCTGAACAGTGTGGATGCCGGGCAGCGTAGCCAGTTGTTTAGCTTCACTCGC
CAGATGCAGGGCCTGCACGATTACGTCGTGCAACTGCTGGAAGGCATTCTGTACCGTGGAGAACATGCCC
AGCCGCTGTTACGGGGGGTTTATCTCACGTCTGCCCAGCAACGCGGGCAAATGGACGATATCTTTACCCA
ATCTGCCGCGGTGCAATATCACCTTGCGCCACAGGCCTTCCCGACCTGGCCGGTCTCGGATACGACGCCG
TATTTTACCAAAGCGCTGTTTAACCAGGTGCTATTGGCCGAACCCAATCTGGCCGGAGAGAACGGTATCT
GGCTGCAAAAAACGAGAAAGCGAATGTTCATTTTCTCGGGGGTGGGTGCCCTGGCCGCGCTGACCTTATG
GGGCTACTGGCACTACTATCACCAGCTTAACTACCGGGCTGGCGAAGAGGTATTAACCCAGGCAAAAACC
TTCTTATCGATCCCACCGCCAGAAGGCGATGACCGTTATGGCAATCTGCAACTGCCGCTGCTAAACCCCA
TCCGTGACGCCACGCTGGCTTACGGTAATTACCATGAACGCAGCCCGTTCCTGGCGGATATGGGGTTATA
TCAGGGCAATAATATCGGGCCTTATGTCGAAAGCACTTACTTGCAACTCCTACAGCAACGTTTTGTCCCG
GCACTGATGAGCGGGCTGTTAGAACAACTGAACGCCGCGCCGAAGGGCAGTGAAGAGAAACTGGAAATTC
TGCGGGTGATGCGGATGTTGGAAGACGGCAGTGGCCGCAATGCCGCGCTGGTTGAACAATATATGAGCCA
CCGCTGGAGCCAACAATTCAACGGCCAGCGCGAGTTGCAGGAGCAACTGTCGAGCCACCTGAACTACGCA
CTGAAACACACCGACTGGCACGGCGCACGGGAAAGTGGCGATCAATATGCGATCAAGAGCTTTGTTCCGT
ACCTCCGCCCGATCCAGTCAGCGCAGCAAGAGTTGAGCAAACTCTCGATCTACCAACGGGTGTATCAGAA
CCTGCGGATCAAAGCACAGGATGCGTTGCCGCCCGCGCTCGATTTGCGCGATCAGATCGGCGCAAGTTTT
GACGACATCTTTGTCTCCGGTAACGATCGCCTGCTGGTGATCCCGCAATTCCTGACCCGTAGCGGCTTAC
AGAGTTACTTCATCAAACAGAACGATCAACTGGTTGATCTCACGGTGATGGACAGTTGGGTACTTAATCT
CACCAAGAACGTCGAATACAGCGAGGCAGACCGCAAAGAGATCCATCGCCAGGTGACCGAACAGTATCTT
GGCGATTATACCGCCACCTGGCGTGCGGCTATGAATAACCTGTCGGTCAGTGATTTTGAAGGCTTGCCAC
AGGCGATCAGCGCCATTGAACAGGTGATCAGCGGGGAACAACCTTTCCGCCGTGCACTGCAAACGCTGAG
TGACAACACCCGCTTGCCGGTTATCTCGGATCTGATCCCCGCGAAGGAGCAGCAAGAGCTGCTGCAAAAA
CCCGATTACCTGCTGCTGACCCGCATCAACCGTGAGTTCTCCCCCGAAACGGCGGTGCTGGTGGAGAATG
GCGATAAAGGCAGCGTGATCCAAAGTGTTTACCAAAAACTGACCGAGCTACACCGCTATCTGTTGGCGAT
CCAAAACTCGCCCGCGCCGGGCAAAGCGGCGTTGAAGGCGGTGCAATTACGTCTGGATCAAAACAACAGT
GATCCGATTTTTGAAGTCCAGCAACTGGCTAAAAACCTGCCGGAGCCGCTAAACCGTTGGGTGGGCGAAC
TGGCAGAGCAAGCCTGGCGGGTGGTGATGATGGAGGCGATCCAGTCACTGGAAGTGGAGTGGAATGAGAC
GGTGATCAAACAGTATCAAACCTACCTGGCCGGACGTTATCCCTTCGATCCTCACGCGAAACAGGATGTA
CCACTCAGTGAGTTTGAACGCTTCTTCGGGCCGAAAGGCACGCTCGATGCATTCTATCAGCAGAACCTGA
AACCGTTTGTCGAAAACAACCTGACCGGTGGCAGCGATGGCGAATTGCTGATCCGGCCTGATGTGTTACA
GCAACTGGCGCAGGCACGGAAAATTCGCGACACCTTCTTCTCGGCCCAAAACGGCCTGGGCACACAGTTT
GCGATTGAACCGGTGCTGTTAAGTGGCAACAAGCGCCGCAGCGTATTGAATCTGGATGGGCAATTACTGG
ATTACGCCCATGGCCGCAGCGGCGTAGTGCATCTGGTTTGGCCAAACTCGATGCGTGCAGGAGTGGAAAG
CAAACTGACGTTAGTCCCGGATGAGAGCGGCAAATCACCGCGCACCCTCAGCTTCAGCGGTCCTTGGGCG
CAGTTGCGGCTGATCAACGCCGGTGAACTGACCAATGTGGGCACCAACTCCTTCGATGTCCGCTTCAAGG
TTGATGGCGGCGAGATGACGTACCGCATCTTTGTTGATGAATCCGACAACCCATTCGCGGGCGGTTTGTT
CAGTAAATTCAGTCTGCCAGACACTCTGTATTGA
 Primer design