SecReT6
Protein ID: 108812380
SecReT6 ID131
T6SS typeN/A
Gene symbol-
Locus tagYPN_2219
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]2504371..2504850 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ1CHI3
KEGG IDypn:YPN_2219
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-16, Aligned region: 35..138
Protein Sequence: 159 a.a.     [Download]
>gi|108812380|ref|YP_648147.1| hypothetical protein YPN_2219 [Yersinia pestis Nepal516]
MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDPQRHKWVATSV
LNYGISPLVGLYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQARNGIIQFEIRGLIKWNPHPID
LCIEGAYDVETDNAELRAR
 
Nucleotide Sequence: 480 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c2504850-2504371 Yersinia pestis Nepal516 chromosome, complete genome
ATGGAAAAGAAAAAACAGTTTTTACCGGCGTTGTTAGAGCGTTTACTCGATGATGAGCCTAAAAAGCATA
TTGAGCCTCACGATAAATTCTTTTATGACTCACGGACGATGCGGAAATTGGTACAACGTAATATTTCAGA
GATATTAAATAATGCCAATATTGAAGACCGGTTGGATCCGCAGCGTCATAAATGGGTAGCGACGTCGGTC
TTAAACTATGGTATTTCACCCCTGGTCGGGCTTTATGCCGTGCCGCATAATTGGGCGACTATTGAACGAA
TTATCAGAGAGGCCATTATCCGTTTTGAACCACGGATAATGGCGGAATCTCTCGTTGTCAGCCAGCAACT
CCAGGCCAGGAATGGCATTATACAGTTTGAGATTAGGGGGTTAATCAAATGGAACCCGCACCCTATCGAT
CTTTGTATTGAAGGTGCCTATGACGTTGAGACGGATAACGCAGAGCTACGCGCCCGTTGA
 Primer design