SecReT6
Protein ID: 108812385
SecReT6 ID131
T6SS typeN/A
Gene symbol-
Locus tagYPN_2224
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]2513745..2514581 [-]
ProductOmpA family protein
NoteTssL
UniProt IDQ1CHH8
KEGG IDypn:YPN_2224
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-18, Aligned region: 18..111
OmpA [PF00691], Evalue: 1.70E-16, Aligned region: 172..270
Protein Sequence: 278 a.a.     [Download]
>gi|108812385|ref|YP_648152.1| OmpA family protein [Yersinia pestis Nepal516]
MGRWWRYKWITFHPSLTYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALS
PHGLIAHQNRRRRGIFVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLR
LSILLKDEIAKQLVSVDETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDS
MPINKPGFPNNQVLSEKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 837 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c2514581-2513745 Yersinia pestis Nepal516 chromosome, complete genome
TTGGGCCGTTGGTGGAGATATAAGTGGATCACTTTTCATCCGTCGTTGACATATGCGGATGGTTTAGAGG
TTTTGCTGCGCATTTTAGGGCTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATT
AACTAAAATACGCCAAGGGTTGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCACCGGCACTTTCT
CCGCATGGGTTGATCGCACATCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGC
TGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGA
CTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGA
CTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCA
AAGTCATCTTTAAAGGCGACTCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGT
AATTAAACGCGTCGCGCAGGAAGTGCATCGCGTTAAAGGGGCAATCCTCATCGTCGGGCATACAGACTCT
ATGCCGATTAATAAACCCGGCTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCAC
GCTATATGGAGCAGGCCGGTATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGT
TAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA
 Primer design