SecReT6
Protein ID: 108813729
SecReT6 ID134
T6SS typeN/A
Gene symbol-
Locus tagYPN_3569
StrainYersinia pestis Nepal516
Repliconchromosome [GenBank: NC_008149] [Browse all T6SS(s) in this replicon]
Location [Strand]4074203..4077736 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ1CDN4
KEGG IDypn:YPN_3569
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.00E-89, Aligned region: 507..822
ImcF-related_N [PF14331], Evalue: 1.40E-69, Aligned region: 201..455
DUF1215 [PF06744], Evalue: 4.80E-39, Aligned region: 309..323
DUF1215 [PF06744], Evalue: 4.80E-39, Aligned region: 916..1035
DUF4131 [PF13567], Evalue: 0.0007, Aligned region: 15..93
DUF4131 [PF13567], Evalue: 0.0007, Aligned region: 444..477
MMR_HSR1 [PF01926], Evalue: 0.0028, Aligned region: 133..273
Protein Sequence: 1177 a.a.     [Download]
>gi|108813729|ref|YP_649496.1| hypothetical protein YPN_3569 [Yersinia pestis Nepal516]
MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQLGENYPFETLLSRWLVTAVFVLVAVC
WLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQQNHYLNGWKHQLQRHLNTPEYLYRLPWYMVIGARNS
GKSTLIKEGYKLTEISASERLHAEDAADLRVRCWLGEQAVIIDPAGVLIEQPTTPIAGKASLNSRLWQSL
LSWLIEQRQRQPLNGIILTVDLHQMMTANKAQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGF
EAMYQSLDKAEREAVLGVTFSLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAGQRSQLFSFTR
QMQGLHDYVVQLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSAAVQYHLAPQAFPTWPVSDTTP
YFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGVGALAALTLWGYWHYYHQLNYRAGEEVLTQAKT
FLSIPPPEGDDRYGNLQLPLLNPIRDATLAYGNYHERSPFLADMGLYQGNNIGPYVESTYLQLLQQRFVP
ALMSGLLEQLNAAPKGSEEKLEILRVMRMLEDGSGRNAALVEQYMSHRWSQQFNGQRELQEQLSSHLNYA
LKHTDWHGARESGDQYAIKSFVPYLRPIQSAQQELSKLSIYQRVYQNLRIKAQDALPPALDLRDQIGASF
DDIFVSGNDRLLVIPQFLTRSGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEYSEADRKEIHRQVTEQYL
GDYTATWRAAMNNLSVSDFEGLPQAISAIEQVISGEQPFRRALQTLSDNTRLPVISDLIPAKEQQELLQK
PDYLLLTRINREFSPETAVLVENGDKGSVIQSVYQKLTELHRYLLAIQNSPAPGKAALKAVQLRLDQNNS
DPIFEVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAIQSLEVEWNETVIKQYQTYLAGRYPFDPHAKQDV
PLSEFERFFGPKGTLDAFYQQNLKPFVENNLTGGSDGELLIRPDVLQQLAQARKIRDTFFSAQNGLGTQF
AIEPVLLSGNKRRSVLNLDGQLLDYAHGRSGVVHLVWPNSMRAGVESKLTLVPDESGKSPRTLSFSGPWA
QLRLINAGELTNVGTNSFDVRFKVDGGEMTYRIFVDESDNPFAGGLFSKFSLPDTLY
 
Nucleotide Sequence: 3534 bp     [Download]
>gi|108810166|ref|NC_008149.1|:c4077736-4074203 Yersinia pestis Nepal516 chromosome, complete genome
ATGAAATTGCCGTTCTTTATACGCATAGCCAAGCCCGCCATTCCTCGCCTTAAAGCGTCAATACCGGTGG
TATTGGCGTTGATGGCTTGTGCGGCACTCATTTGGGTATGGATTTACGGACCCGAGTGGCAATTGGGGGA
AAATTACCCGTTTGAGACATTATTGAGCCGTTGGTTGGTCACGGCGGTATTTGTCTTGGTGGCCGTTTGT
TGGCTCAGCCTGAAAGTCATGAGGCGAGTACAACACCTGGAAAAACTCCAACTGCAAACGAAAATTCAGC
TCGACGACCCCGTCAGTGCTGATATCGAGCAACAAAACCACTACCTCAATGGCTGGAAGCACCAACTTCA
GCGCCATTTGAACACCCCGGAATATCTGTATCGCCTGCCCTGGTACATGGTCATTGGTGCGCGCAATAGC
GGCAAAAGTACACTGATCAAAGAAGGGTATAAACTGACAGAGATCTCCGCATCCGAGCGGCTCCATGCGG
AAGACGCAGCAGATCTGCGCGTCCGCTGCTGGTTGGGGGAACAAGCGGTTATTATCGATCCTGCGGGGGT
GCTGATTGAACAACCTACGACACCGATCGCGGGCAAAGCATCACTCAACAGCCGCTTATGGCAAAGTCTA
TTATCCTGGCTGATTGAACAGCGCCAGCGTCAGCCGCTAAACGGCATTATTCTCACCGTCGATCTTCATC
AGATGATGACCGCGAATAAAGCGCAGCGGGAGACTTACGTCGCTGATATTCATCAACGGCTGCAAGAGAT
ACGGCTGTCTTTGCACAGCCAGGTGCCGCTGTATGTGGTGTTCACCAAAATGGACCTGCTGTACGGCTTC
GAGGCCATGTACCAATCGCTGGATAAAGCCGAACGTGAAGCGGTTCTGGGGGTGACGTTCAGCCTCAATG
CGGCGGATCCGGACGTGTGGCGGACGGAGTTGAAACAGTTCTGGCAGCAATGGGTCGCACAACTGAATGG
CGCGATGCCGGACATGATGCTGAACAGTGTGGATGCCGGGCAGCGTAGCCAGTTGTTTAGCTTCACTCGC
CAGATGCAGGGCCTGCACGATTACGTCGTGCAACTGCTGGAAGGCATTCTGTACCGTGGAGAACATGCCC
AGCCGCTGTTACGGGGGGTTTATCTCACGTCTGCCCAGCAACGCGGGCAAATGGACGATATCTTTACCCA
ATCTGCCGCGGTGCAATATCACCTTGCGCCACAGGCCTTCCCGACCTGGCCGGTCTCGGATACGACGCCG
TATTTTACCAAAGCGCTGTTTAACCAGGTGCTATTGGCCGAACCCAATCTGGCCGGAGAGAACGGTATCT
GGCTGCAAAAAACGAGAAAGCGAATGTTCATTTTCTCGGGGGTGGGTGCCCTGGCCGCGCTGACCTTATG
GGGCTACTGGCACTACTATCACCAGCTTAACTACCGGGCTGGCGAAGAGGTATTAACCCAGGCAAAAACC
TTCTTATCGATCCCACCGCCAGAAGGCGATGACCGTTATGGCAATCTGCAACTGCCGCTGCTAAACCCCA
TCCGTGACGCCACGCTGGCTTACGGTAATTACCATGAACGCAGCCCGTTCCTGGCGGATATGGGGTTATA
TCAGGGCAATAATATCGGGCCTTATGTCGAAAGCACTTACTTGCAACTCCTACAGCAACGTTTTGTCCCG
GCACTGATGAGCGGGCTGTTAGAACAACTGAACGCCGCGCCGAAGGGCAGTGAAGAGAAACTGGAAATTC
TGCGGGTGATGCGGATGTTGGAAGACGGCAGTGGCCGCAATGCCGCGCTGGTTGAACAATATATGAGCCA
CCGCTGGAGCCAACAATTCAACGGCCAGCGCGAGTTGCAGGAGCAACTGTCGAGCCACCTGAACTACGCA
CTGAAACACACCGACTGGCACGGCGCACGGGAAAGTGGCGATCAATATGCGATCAAGAGCTTTGTTCCGT
ACCTCCGCCCGATCCAGTCAGCGCAGCAAGAGTTGAGCAAACTCTCGATCTACCAACGGGTGTATCAGAA
CCTGCGGATCAAAGCACAGGATGCGTTGCCGCCCGCGCTCGATTTGCGCGATCAGATCGGCGCAAGTTTT
GACGACATCTTTGTCTCCGGTAACGATCGCCTGCTGGTGATCCCGCAATTCCTGACCCGTAGCGGCTTAC
AGAGTTACTTCATCAAACAGAACGATCAACTGGTTGATCTCACGGTGATGGACAGTTGGGTACTTAATCT
CACCAAGAACGTCGAATACAGCGAGGCAGACCGCAAAGAGATCCATCGCCAGGTGACCGAACAGTATCTT
GGCGATTATACCGCCACCTGGCGTGCGGCTATGAATAACCTGTCGGTCAGTGATTTTGAAGGCTTGCCAC
AGGCGATCAGCGCCATTGAACAGGTGATCAGCGGGGAACAACCTTTCCGCCGTGCACTGCAAACGCTGAG
TGACAACACCCGCTTGCCGGTTATCTCGGATCTGATCCCCGCGAAGGAGCAGCAAGAGCTGCTGCAAAAA
CCCGATTACCTGCTGCTGACCCGCATCAACCGTGAGTTCTCCCCCGAAACGGCGGTGCTGGTGGAGAATG
GCGATAAAGGCAGCGTGATCCAAAGTGTTTACCAAAAACTGACCGAGCTACACCGCTATCTGTTGGCGAT
CCAAAACTCGCCCGCGCCGGGCAAAGCGGCGTTGAAGGCGGTGCAATTACGTCTGGATCAAAACAACAGT
GATCCGATTTTTGAAGTCCAGCAACTGGCTAAAAACCTGCCGGAGCCGCTAAACCGTTGGGTGGGCGAAC
TGGCAGAGCAAGCCTGGCGGGTGGTGATGATGGAGGCGATCCAGTCACTGGAAGTGGAGTGGAATGAGAC
GGTGATCAAACAGTATCAAACCTACCTGGCCGGACGTTATCCCTTCGATCCTCACGCGAAACAGGATGTA
CCACTCAGTGAGTTTGAACGCTTCTTCGGGCCGAAAGGCACGCTCGATGCATTCTATCAGCAGAACCTGA
AACCGTTTGTCGAAAACAACCTGACCGGTGGCAGCGATGGCGAATTGCTGATCCGGCCTGATGTGTTACA
GCAACTGGCGCAGGCACGGAAAATTCGCGACACCTTCTTCTCGGCCCAAAACGGCCTGGGCACACAGTTT
GCGATTGAACCGGTGCTGTTAAGTGGCAACAAGCGCCGCAGCGTATTGAATCTGGATGGGCAATTACTGG
ATTACGCCCATGGCCGCAGCGGCGTAGTGCATCTGGTTTGGCCAAACTCGATGCGTGCAGGAGTGGAAAG
CAAACTGACGTTAGTCCCGGATGAGAGCGGCAAATCACCGCGCACCCTCAGCTTCAGCGGTCCTTGGGCG
CAGTTGCGGCTGATCAACGCCGGTGAACTGACCAATGTGGGCACCAACTCCTTCGATGTCCGCTTCAAGG
TTGATGGCGGCGAGATGACGTACCGCATCTTTGTTGATGAATCCGACAACCCATTCGCGGGCGGTTTGTT
CAGTAAATTCAGTCTGCCAGACACTCTGTATTGA
 Primer design