SecReT6
Protein ID: 110277139
SecReT6 ID788
T6SS typei1
Gene symbolvasK
Locus tag110277139
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]19097..22582 [+]
ProductVasK
NoteTssM
UniProt IDQ0PZG0, Q0PZG0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.20E-89, Aligned region: 501..815
ImcF-related_N [PF14331], Evalue: 1.30E-70, Aligned region: 199..452
DUF1215 [PF06744], Evalue: 3.00E-35, Aligned region: 745..775
DUF1215 [PF06744], Evalue: 3.00E-35, Aligned region: 901..1019
AAA_16 [PF13191], Evalue: 0.0068, Aligned region: 109..238
AAA_16 [PF13191], Evalue: 0.0068, Aligned region: 773..788
AAA_16 [PF13191], Evalue: 0.0068, Aligned region: 900..951
Protein Sequence: 1161 a.a.     [Download]
>gi|110277139|ref|ABG57148.1| VasK [Aeromonas hydrophila]
MFKTIFTFLRQQLPKLKPSWPLLGAVLWVLALILVWWLGPRLELRGAKPFEPLWGRVVFTLLWLWLLLGV
VSWRVWRKMQQLKAERQHEVVLEQDPVKGLIDRQALFLDRWLQALNTHLGKGALYAMPWYLVLGLPGSGK
SSLIHRANPANKLNPRLDTELRDVAQDQLVDCWLGEQAVMLDPAGVLLSQSEAELDPQARKHERLWLHLL
GWLNEHRRRQPLNGLVLTVDLAWLSHASVAERKAYAQLMRSRLQEVSATMNTRLPLYVTFTKLDLLRGFD
VIYQQLDKEAREAVLGVTFKPGADWQQDLALFWDQWVDNLNQNLPELMLSRLDAAQRNALFSFVRQLAGL
KDYVTSLLAETLAIEESKPLLVRGVYVSSVYQQGVPFDAFAQAASRRYNLPEPIHSALRGESNTYFVRQL
FSSIIFPEAHLAGENRLHTLYRRRRMAIGLSCLSLFSAALIGGWHYFYRVNEEAGRNVLTKAQAFMETNE
VADAHAFGVSQLPRLNLIREATLSFGNYRERMPLVADLGLYQGDEIGPYVEGSYLQLLSLRFLPAQMQGL
LEDLNQAPAGSEEKLAILRVMRMLDDASGRNKELVAQYMASRWQKAFPGQGAVQEQLMGHLDYALDHTNW
YGARAERDQAAITAFVPFKEPVYGAQRELGKLPMYQRVYQNLVVKANDVLPPDLNVRDEVGPTFDTVFAL
RSDNAGQVPRLLTWPGFNDFFLKQDKALIDLTAMDAWVLGQRKLSQLSEADRKEITRQVNDRYVTDYVNQ
WQKLLTNLDVQTLESPEQALDVLAAITGNDQPFQRVLASLDDNTRIRKISDVEGDPAQAISARIGRPFMA
TNGVLAGRGEQGPLIQEVNQKLVELQHYLELIVNATEPGQSALKAVQLRMTNKYADPVFALQQYARSLPA
PLDRWVGQLSEQSSRLVIDLAMSSLNQEWQDKVLAPFNSQLAGRYPFDPSSNKDVPLSEMERFFAPGGTL
DSFYQVNLKPMVESGLMEGEFSSPIQAELVKQLDRAARIRQIFFSQQGNLEVQFALEPIELTANKRRSVL
NLDGQLLEYAHGRRTKIPLVWPNTMRDGAESKITLVPAARERSPRSEGFVGPWAMLRLMDKGELTQVNDA
TFDVRFPVDQGAMTYRVYTDSAQNPFTGGLFSQFRLPESLY
 
Nucleotide Sequence: 3486 bp     [Download]
>gi|110277122|gb|DQ667172|vasK|:19097-22582
ATGTTCAAAACCATTTTTACTTTTCTGCGGCAACAGCTGCCGAAATTGAAACCCTCCTGGCCCCTGCTCG
GTGCAGTGCTCTGGGTGCTCGCCCTCATCCTGGTGTGGTGGCTGGGCCCTCGTCTTGAGCTGCGCGGCGC
CAAGCCGTTCGAGCCGCTGTGGGGGCGGGTGGTGTTCACCCTGCTCTGGCTCTGGCTGCTGCTGGGAGTA
GTCTCCTGGCGGGTATGGCGCAAGATGCAGCAGCTCAAGGCCGAGCGTCAGCACGAGGTGGTGCTGGAGC
AGGATCCGGTCAAGGGGCTCATCGACAGGCAGGCGCTGTTCCTCGATCGCTGGCTGCAGGCGCTGAATAC
CCATCTGGGCAAGGGGGCGCTCTACGCCATGCCCTGGTATTTGGTGCTGGGGCTGCCCGGCAGCGGCAAG
AGCAGCCTCATTCACCGCGCCAACCCGGCCAACAAGCTCAACCCGAGACTCGATACCGAACTGCGCGACG
TGGCGCAGGATCAGCTGGTGGATTGCTGGCTGGGGGAACAGGCGGTGATGCTGGATCCGGCCGGGGTACT
GCTCTCCCAGAGCGAAGCCGAACTGGATCCGCAGGCCCGCAAACATGAGCGGCTCTGGCTGCACCTGCTT
GGCTGGCTCAATGAACATCGCCGTCGCCAGCCCCTCAACGGCCTGGTGCTGACCGTGGATCTGGCCTGGC
TCTCCCACGCCAGCGTGGCTGAACGCAAGGCTTATGCCCAGCTGATGCGCTCGCGCCTGCAGGAGGTGTC
GGCCACCATGAATACCCGGTTGCCGCTCTATGTCACCTTCACCAAGCTCGATCTGCTGCGCGGCTTTGAC
GTGATCTACCAGCAGCTCGACAAGGAGGCCCGCGAGGCCGTGCTGGGGGTGACCTTCAAGCCGGGCGCCG
ACTGGCAGCAGGATCTGGCCCTGTTCTGGGATCAGTGGGTGGACAACCTCAACCAGAATCTGCCCGAACT
GATGCTGAGTCGGCTCGATGCCGCCCAGCGCAACGCGCTGTTCTCGTTCGTGCGCCAGCTGGCGGGACTC
AAGGATTACGTGACCAGCCTGCTGGCCGAGACCCTGGCCATCGAGGAGAGCAAGCCGCTCTTGGTACGCG
GGGTTTATGTTAGCTCCGTCTATCAGCAGGGGGTACCGTTCGATGCGTTTGCCCAGGCAGCCTCCCGCCG
CTACAACCTGCCAGAGCCCATCCACTCGGCCCTGCGTGGGGAGTCGAACACCTATTTCGTGCGCCAGCTG
TTCTCCTCCATCATCTTCCCGGAGGCCCATCTGGCCGGCGAAAACCGGCTGCACACCCTCTATCGCCGTC
GCCGCATGGCCATCGGCCTCAGCTGCCTGTCGCTCTTCTCGGCAGCCCTCATCGGTGGCTGGCACTACTT
CTACCGGGTCAACGAGGAGGCGGGCCGCAACGTATTGACCAAGGCCCAGGCCTTCATGGAGACCAACGAG
GTGGCCGACGCCCACGCCTTCGGCGTGAGCCAGCTGCCGCGCCTCAACCTCATTCGCGAGGCGACCCTCT
CCTTTGGTAACTACCGCGAGCGCATGCCACTGGTGGCCGACCTCGGCCTCTACCAGGGGGACGAAATTGG
TCCCTATGTGGAGGGTTCCTACCTGCAACTGCTGAGCCTGCGCTTCCTGCCGGCCCAGATGCAGGGGTTG
CTTGAGGATCTCAACCAGGCGCCTGCGGGGAGTGAGGAGAAGCTTGCCATCCTGCGGGTGATGCGGATGC
TGGACGATGCGTCCGGTCGCAACAAGGAGCTGGTGGCGCAGTACATGGCGAGCCGCTGGCAGAAGGCCTT
CCCGGGGCAGGGGGCGGTACAGGAGCAACTGATGGGGCACCTGGACTATGCCCTCGATCACACCAACTGG
TATGGCGCCAGGGCAGAGCGGGATCAGGCCGCCATCACCGCCTTCGTGCCCTTCAAGGAGCCGGTCTACG
GTGCCCAGCGCGAGCTCGGCAAGCTGCCCATGTATCAGCGGGTCTACCAGAACCTGGTGGTGAAGGCGAA
CGACGTGCTGCCGCCGGATCTCAACGTGCGTGACGAGGTGGGCCCCACCTTCGACACCGTGTTTGCCCTG
CGCAGCGACAACGCCGGCCAGGTGCCGCGGCTGCTGACCTGGCCCGGTTTCAACGACTTCTTCCTCAAGC
AAGACAAGGCCCTCATCGATCTCACCGCCATGGATGCCTGGGTGCTGGGCCAGCGCAAGCTGAGCCAGCT
GAGCGAGGCGGATCGCAAGGAGATCACCCGTCAGGTCAACGACCGTTACGTCACCGATTACGTCAACCAG
TGGCAGAAACTGCTGACCAATCTGGATGTGCAGACCCTGGAGAGCCCGGAGCAGGCGCTGGACGTGCTCG
CTGCCATTACCGGCAACGATCAGCCGTTCCAGCGGGTACTGGCCTCGCTGGATGACAACACCCGCATTCG
CAAGATCTCCGATGTGGAAGGGGACCCGGCCCAGGCCATCAGCGCCCGCATCGGTCGCCCCTTTATGGCC
ACTAATGGAGTATTGGCTGGACGTGGTGAGCAGGGGCCGCTCATTCAGGAGGTCAACCAGAAGCTGGTGG
AGCTGCAGCACTACCTGGAGCTCATCGTCAACGCCACCGAGCCGGGCCAGTCTGCCTTGAAAGCGGTGCA
GCTGCGCATGACCAACAAGTACGCCGATCCGGTGTTCGCGCTGCAGCAATATGCCCGCAGCCTGCCGGCC
CCGCTCGATCGCTGGGTGGGTCAGCTCTCCGAGCAGAGCTCGCGGCTGGTGATCGACCTGGCCATGTCCT
CCCTCAACCAGGAGTGGCAGGACAAGGTGCTGGCGCCCTTCAACAGCCAGCTGGCCGGCCGTTATCCGTT
TGATCCGAGCTCGAACAAGGACGTGCCCCTCTCCGAGATGGAGCGCTTCTTCGCGCCGGGCGGGACGCTG
GACAGCTTCTATCAGGTCAACCTCAAACCCATGGTGGAGAGCGGCCTGATGGAAGGGGAGTTCAGTTCGC
CCATCCAGGCCGAGCTGGTCAAACAGCTGGACCGTGCTGCCCGCATCCGTCAGATCTTCTTCAGCCAGCA
GGGCAACCTGGAGGTGCAGTTCGCCCTCGAGCCCATCGAGCTCACCGCCAACAAGCGGCGCAGCGTGCTG
AACCTGGATGGTCAGCTGTTGGAATACGCCCATGGCCGCCGTACCAAGATCCCGCTGGTGTGGCCCAACA
CCATGCGCGACGGGGCCGAGAGCAAGATCACCCTGGTGCCTGCCGCCCGCGAGCGTTCACCGCGCAGTGA
AGGCTTCGTCGGCCCCTGGGCCATGCTCCGCCTGATGGACAAGGGGGAGCTGACCCAGGTCAATGACGCC
ACCTTCGATGTGCGCTTCCCGGTGGATCAGGGGGCCATGACCTATCGCGTCTACACCGACAGCGCGCAAA
ACCCCTTCACCGGCGGTCTGTTCAGCCAGTTCAGACTGCCTGAATCCCTCTATTGA
 Primer design