SecReT6
Protein ID: 110640434
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0226
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]244617..248144 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDQ0TLB8
KEGG IDecp:ECP_0226
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.20E-83, Aligned region: 507..820
ImcF-related_N [PF14331], Evalue: 1.00E-59, Aligned region: 210..457
ImcF-related_N [PF14331], Evalue: 1.00E-59, Aligned region: 818..885
DUF1215 [PF06744], Evalue: 1.70E-32, Aligned region: 305..323
DUF1215 [PF06744], Evalue: 1.70E-32, Aligned region: 916..1034
Protein Sequence: 1175 a.a.     [Download]
>gi|110640434|ref|YP_668162.1| IcmF-like protein [Escherichia coli 536]
MFKFPTSRLFSTLKSALRPAMPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAV
WGLIALVWLTWRVMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYM
VIGPAGSGKSTLLREGFPSDIVYTPESIRGVEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRRLREH
WLGWLMQTRARQPLNGLILTLDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNG
FAALFHSLDKKDRDAILGVTFTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFS
RQMQGTGEIVTALLAALLDGENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTP
YFTRRLFPEVLLAEPNLAGENSVWLNSSRRRLTAFSTCGAALAALMVGSWHHYYNQNWQSGVNVLAQAKA
FMDVPLPQGTDEFGNLQLPLLNPVRDATLAYGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPS
LMNGLIRDLNIAPPESEEKLAVLRVVRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYAL
EHTDWHAQRQSSDSDAVSRWTPYNKPVINAQHELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFD
NVFVAGNDEKLVIPQFLTRYGLQSYFIKQHDGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYLS
DYTATWRAGMDNLNVRDYETMPALTDALEQIISGDQPFLRALTALRDNTHALTLSGKLDDKAKEAAINEM
DYRLLSRLGHEFAPENSALEEQKDKASTLQAVYQQLTELHRYLLAIQNSPVSGKSALKAVQLRLDQNSSD
PIFATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPHATQDAS
LDSFERFFKPDGILDNFYKNNLRLFLENDLTFGDDGRMLIREDIRQQLDTAQKIRNIFFSQQNGLGAQFA
VETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESQLTLIGTSGRAPRSIAFSGPWAQF
RLFGAGQLTNVTSDTFNVRFNVDGGAMVYRVHVDTEDNPFTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c248144-244617 Escherichia coli 536, complete genome
GTGTTCAAATTTCCCACATCCCGACTGTTCAGCACGTTGAAATCTGCGCTCAGGCCAGCGATGCCGCGGT
TTAAAGTTTCTGCCACCTGGCTACTGACGCTGGCATGGATTTTTCTGCTGGTGTGGATCTGGTGGCAGGG
TCCAAAATGGACGCTCTATGAGCAGCACTGGTTGGCTCCGCTGGCAAACCGCTGGCTGGCGACCGCCGTC
TGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGGGTGATGAAGCGTCTGCAAAAGCTGGAAAAACAGC
AGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGCAATATCTGGA
TCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCCGTGGTATATG
GTCATTGGTCCTGCGGGTAGCGGCAAAAGCACGCTGCTGCGCGAGGGCTTTCCGTCTGACATTGTTTACA
CGCCGGAAAGCATCCGGGGTGTGGAATACCACCCGCTGATCACACCGCGAGTGGGCAACCAGGCGGTAAT
TTTCGATGTTGACGGCGTACTGACCACTCCCGGCGGGGATGATCTGCTCCGCCGCCGCCTGCGCGAACAC
TGGCTGGGCTGGCTGATGCAAACGCGCGCTCGCCAGCCGCTCAACGGTCTTATCCTGACGCTCGATCTTC
CCGATCTGCTGACGGCGGATAAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGCAACTTCAGGA
GATCCGTCAGAGCCTGCACTGCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCTGCTGAACGGC
TTTGCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACATTTACCCGCC
GCGCCCATGAAAGTGACGGCTGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTACAACAGGTGAA
CCTGGCGCTGTCGGATCTGGTGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCTGTGTTCAGCTTCTCC
CGTCAGATGCAGGGAACAGGAGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGTGAGAACATGG
ATGTAATGCTGCGTGGCGTCTGGCTCACATCCTCGCTACAGCGTGGCCAGGTGGATGATATTTTCACGCA
GTCCGCCGCCCGCCAGTACGGACTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGAGACGACGCCG
TATTTTACTCGCCGCCTCTTCCCGGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAAAACAGCGTCT
GGCTGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCACCTGTGGCGCGGCACTGGCGGCATTGATGGT
CGGAAGCTGGCACCATTATTACAATCAGAACTGGCAGTCTGGCGTTAACGTACTGGCACAAGCTAAAGCC
TTTATGGACGTACCACTACCGCAGGGAACGGATGAATTCGGCAATCTGCAATTGCCATTGCTTAACCCGG
TACGCGATGCCACCCTGGCCTATGGTGATTATCGCGATCACGGTTTTCTGGCGGATATGGGATTGTACCA
GGGCGCCCGCGTAGGGCCGTATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTATCTCCCCTCG
TTAATGAACGGCCTGATCCGGGATCTAAACATTGCCCCGCCAGAGAGCGAAGAAAAGCTCGCTGTGCTGC
GCGTAGTGCGCATGATGGAAGACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACATGGCGCGGCG
CTGGAGCAATGAATTTCACGGCCAGCGCGATATTCAGGCGCAACTGATGGTGCATCTGGACTATGCGCTG
GAGCACACCGACTGGCACGCGCAGCGCCAAAGCAGCGACAGCGATGCTGTAAGCCGCTGGACCCCCTATA
ATAAACCGGTCATTAATGCGCAACATGAACTGAGCAAGCTACCCATATACCAGCGTGTCTACCAGACCCT
TCGCACCAAAGCATTAAGCGTGTTACCCGCCGATTTGAATTTGCGCGACCAGGTTGGTCCCACCTTCGAC
AACGTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATCCCGCAGTTTCTCACCCGCTATGGCCTGCAAA
GCTATTTTATCAAACAACACGACGGTCTCGTTGAGTTGACCGCGCTGGATTCGTGGGTGCTGAACCTGAC
GCAAAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGATCCAGCGCCATATCACTGAACAGTACCTCAGT
GACTATACCGCTACATGGCGTGCCGGAATGGATAATCTCAACGTCCGTGACTATGAGACCATGCCGGCGC
TGACCGACGCGCTGGAGCAGATTATCAGCGGTGATCAGCCATTCCTGCGTGCTCTGACGGCGCTGCGCGA
TAATACACACGCGCTGACGCTCTCCGGCAAACTGGACGATAAGGCGAAGGAAGCGGCGATAAATGAGATG
GATTACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCGCCGGAAAATAGCGCACTGGAGGAGCAAAAGG
ACAAGGCGAGTACTCTACAGGCCGTGTATCAGCAACTGACCGAGCTGCACCGTTACCTGCTGGCGATCCA
GAACTCGCCAGTGTCTGGGAAATCGGCGCTGAAAGCAGTACAGCTACGGCTGGATCAAAACAGCAGCGAT
CCAATCTTCGCCACCCGTCAGATGGCAAAAACCCTGCCTGCGCCTCTTAACCGCTGGGTAGGTAAGCTGG
CGGATCAGGCCTGGCATGTAGTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGCGCGACAATGT
AGTGAAACCCTTCAACGAGCAGCTTGCCGATAACTATCCGTTTAATCCGCACGCCACACAGGATGCCTCA
CTGGATTCGTTTGAACGTTTCTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAACAACCTGCGCC
TGTTCCTTGAAAACGATCTGACCTTTGGCGACGACGGCAGAATGTTAATCCGTGAAGATATCCGGCAGCA
ACTGGATACTGCGCAGAAAATCCGCAACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGCACAGTTTGCC
GTGGAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAGTTAGTGGACT
ACAGCCAGGGACGCAACTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAAGCCA
GCTGACGCTGATTGGCACCAGCGGCAGAGCACCGCGCAGTATCGCGTTCAGCGGACCGTGGGCGCAGTTC
CGCCTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTTAACGTGGACG
GCGGCGCGATGGTTTACCGGGTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTCTGTTCAGCCA
GTTCCGTTTACCGGATACGTTGTATTAA
 Primer design