SecReT6
Protein ID: 110642969
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2814
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2960533..2963964 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ0TE31
KEGG IDecp:ECP_2814
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.80E-66, Aligned region: 428..745
IcmF-related [PF06761], Evalue: 4.80E-66, Aligned region: 806..847
DUF1215 [PF06744], Evalue: 1.50E-35, Aligned region: 462..495
DUF1215 [PF06744], Evalue: 1.50E-35, Aligned region: 866..985
Protein Sequence: 1143 a.a.     [Download]
>gi|110642969|ref|YP_670699.1| hypothetical protein ECP_2814 [Escherichia coli 536]
MGDRGVAIRFPTGGIIVVPGLNRLRPRSVSGPAIVMTVAVVVALCTFIHRKPALLGVEPGSSQQMYWMAG
VIAAGVVFLIIMGVYHLLNRHAAVQSFELRRQLAAGDDYRAVTTKKADRRHPAMVELAAFLRDRYGPFWR
RKIRLLLVTGEPEQAEAIAPGLTGQHWLEGDHTVLIYGGRPSAEPDVTLLAALKKLRRSRPLDGIIWPLT
EEQSRQTAQLDKGWRELVNGSKRLGFQAPLYLWQVCDNGDYQTGRPLQSVGCLLPERCTPEQLAAMLEAQ
TLPLTEQGMSQLLADNRHDFLLRLAHTLAERGIAHWQSVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAA
PHAWLPSPVWAGITGDNARGRAVGFPWLRTALMSAVCVLVIWGAGMTTSFFANRALVQETGIQTARALDT
RLPLAEQLVALHTLQGELERLQYRIREGAPWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQ
LNAFVALPPNSPQRTATGEQRYKQLKALLMTSRPEKADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLT
FWTANLPEHPQWKTSPPPELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESL
FSTEQTVPGMFTRQAWEGQVREAIEQVVTARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGS
WLAFLNSIHWKKEDSLSGILDQLTLMADARQSPLIALTDTLAWQAAAGRENRGLSDSLAKSAQELFNGKE
KTPQQSREGDVPVGPLDKTFAPLLRLLGDKAGGGDSQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQL
AQTVLQGKTVDLTDTRDYGRLIAASLGEEWSGFGQALFVRPMEQSWRQVLTPAADSLNRQWQRAIVSHWN
QDFAGRYPFKASQNDASLPLLAQYLRDDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRAL
NRLRDVADTAFASGDAGIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWT
STQAMERILADYRGSWSLIRLLEQAQVTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRL
PGQVFLTGRSMKDAEEYGEDADE
 
Nucleotide Sequence: 3432 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2960533-2963964 Escherichia coli 536, complete genome
ATGGGCGACCGTGGTGTCGCCATTCGTTTCCCCACAGGAGGCATCATAGTGGTTCCAGGATTAAACCGTC
TCCGGCCCCGTTCGGTTTCAGGGCCTGCCATCGTCATGACCGTGGCTGTTGTGGTTGCGCTTTGCACGTT
TATTCACCGTAAACCGGCATTGCTGGGCGTTGAACCGGGTAGCTCACAGCAAATGTACTGGATGGCTGGC
GTGATTGCCGCTGGCGTGGTCTTTCTGATTATCATGGGGGTTTATCATCTGCTGAACCGCCACGCTGCCG
TACAGAGCTTTGAACTCCGCAGACAGCTTGCCGCCGGGGATGACTATCGGGCGGTGACGACAAAGAAAGC
CGACAGACGTCATCCGGCAATGGTGGAACTCGCCGCCTTCCTGCGCGACCGCTACGGCCCGTTCTGGCGG
CGTAAAATCCGCCTGCTGCTGGTGACCGGCGAGCCTGAACAGGCAGAGGCCATCGCGCCGGGGCTGACCG
GGCAACACTGGCTGGAGGGCGACCACACGGTGCTGATATATGGCGGCAGGCCATCAGCGGAGCCTGATGT
CACACTGCTGGCCGCCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGCCACTGACA
GAAGAACAGAGCCGTCAGACAGCGCAACTCGACAAAGGCTGGCGCGAGCTGGTCAACGGCAGTAAGCGAC
TCGGTTTTCAGGCCCCACTCTATTTGTGGCAGGTCTGTGACAACGGTGATTATCAGACCGGACGCCCTCT
GCAAAGCGTCGGCTGCCTGCTGCCGGAACGCTGTACCCCGGAACAACTGGCTGCAATGCTGGAAGCACAA
ACCCTGCCACTGACGGAACAGGGCATGTCGCAGCTGCTGGCCGATAACCGCCATGATTTTCTGCTGCGTC
TGGCCCATACCCTTGCAGAGCGGGGTATCGCTCACTGGCAAAGCGTTCTGAAACCGCTGCTGGCAGGCGG
CGCATTTTCCTCCCTGCGTCTGCGTGGCCTGATGTTCAGCCCGCCGCTTGCCGCCGTACCGGAGGCCGCA
CCTCATGCGTGGCTGCCGTCGCCGGTCTGGGCAGGCATCACCGGCGATAACGCGCGGGGCCGCGCGGTGG
GCTTTCCGTGGCTGCGTACCGCACTGATGTCCGCTGTCTGCGTGCTGGTGATATGGGGAGCCGGAATGAC
GACCTCGTTCTTCGCCAACCGCGCGCTTGTTCAGGAAACCGGTATCCAGACGGCACGTGCGCTTGATACC
CGCCTGCCGCTGGCAGAACAACTGGTGGCGCTGCATACCCTGCAGGGCGAACTGGAGCGCCTGCAATATC
GTATCCGCGAAGGTGCGCCGTGGTATCAGCGTTTTGGTCTTGAACGTAACCAACAACTGCTCGCCGCCGC
CTTTCCCGGCTATGCACAGGCGGCAAACCGGCTGGTGCGCGACGTGGCCGTTGACCATCTGCAACAGCAA
CTTAATGCCTTTGTCGCGCTGCCGCCCAACAGTCCTCAGCGTACCGCCACCGGTGAACAACGCTATAAGC
AGCTTAAGGCATTGCTGATGACTTCCCGCCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGAT
GGCGGACGGTCTGCGCTACGAGAATATCCCGGAAGGTGTGCGGCAGAGCGTGTTGCCGTCACTGCTGACC
TTCTGGACGGCGAACCTGCCGGAACACCCGCAGTGGAAAACATCGCCGCCACCGGAACTGACCGGCGCAG
TGCGTAAAATCCTGCTGCGCCAGATTGGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCA
ACAGGTGTCCCGCAACTACGCCGATATGACGCTGGCGGACATGACCGGGGATACCCTCACCGAATCTCTT
TTCAGTACGGAACAGACGGTGCCGGGGATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCA
TCGAGCAGGTGGTGACGGCGCGGCGCGAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTC
TGCGGATATCTCGCCGGATACGCTGCGTAACCGTCTCACCTCACGCTACTTTACCGACTTTGCCGGAAGC
TGGCTGGCGTTTCTCAACAGCATTCACTGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGTTGA
CACTGATGGCCGATGCCCGTCAGTCGCCACTGATTGCGCTGACGGACACCCTCGCGTGGCAGGCGGCGGC
AGGCAGGGAAAACCGTGGTCTGTCAGACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAG
AAAACGCCGCAGCAATCCCGTGAAGGTGACGTGCCTGTCGGGCCGCTGGATAAAACCTTCGCTCCGCTGC
TGCGGTTGCTGGGCGATAAGGCCGGAGGCGGCGACAGCCAACTGAGCCTGCAGACCTACCTCACCCGCGT
CACCCGTGTGCGTCTCAAACTGCAACAGGTGACCAACGCCCCCGACCCACAGGAGATGACCCAGCAACTG
GCGCAGACGGTTTTACAGGGCAAAACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAATCGCCG
CCAGTCTGGGCGAGGAATGGAGTGGCTTCGGTCAGGCGCTGTTCGTCCGCCCGATGGAACAGTCGTGGCG
GCAGGTGCTGACGCCTGCGGCGGACAGCCTGAACCGCCAGTGGCAGCGGGCGATTGTCAGCCACTGGAAT
CAGGACTTCGCCGGTCGCTATCCGTTCAAAGCCTCACAAAACGATGCCTCTCTTCCCCTGCTGGCGCAGT
ATCTGCGCGATGACGGGCGCATCAACCAGTTTATAGCCGCCAACCTTTCCGGCGTACTGAAACGTGAAGG
CCGCTACTGGGTGGCTGACGCCATGAACACGCAGGGGCTGACGGTTAACCCGGACTTTATCCGCGCCCTG
AACCGCCTGCGCGACGTGGCCGATACCGCCTTTGCCAGCGGCGATGCCGGAATACATTTTGAACTGCGGG
CAAAACCGGCGCGTGACGTGATGAAAACGCATCTGGTGATTGACGGACAGGAGCTGGAATATTTCAACCA
GAAAGAACGCTGGCAGCGTTTTAACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTGAGCTGGACC
AGCACTCAGGCAATGGAACGAATACTGGCGGATTACCGGGGAAGCTGGAGCCTTATTCGTCTGCTGGAAC
AGGCGCAGGTGACACCGGTGGACAGCAGCACCTTTAAAGTGGTGTGGAAAGCGCAGGACGGCCTGCCGCT
GAATTACCTGCTGCGGGTTGAACAGGGCAAAGGGCCACTGGCGCTGCTGGAACTGAAAAACTTCCGCCTG
CCGGGACAGGTGTTCCTGACCGGCAGGAGTATGAAGGATGCGGAAGAATACGGAGAAGACGCCGATGAGT
GA
 Primer design